DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and Adcy4

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_062158.2 Gene:Adcy4 / 54223 RGDID:2034 Length:1072 Species:Rattus norvegicus


Alignment Length:258 Identity:76/258 - (29%)
Similarity:116/258 - (44%) Gaps:36/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 HDATREVILVGEQARAQDGL--RRRMDKIKNSIEEANSAVTKERKKNVSLLHLIFP--------A 445
            |.|..|..|......|...|  |||:|              .|:|....||..|.|        |
  Rat   191 HKALMERALRATFREALSSLHSRRRLD--------------TEKKHQEHLLLSILPAYLAREMKA 241

  Fly   446 EIAEKLWLGS-----------SIDAKTYPDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFD 499
            ||..:|..|.           |:..|.:..|::|::||||||.:.|..:|..::.||..|:..||
  Rat   242 EIMARLQAGQSSRPENTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNELFGKFD 306

  Fly   500 EFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMALKMIDACSKHITHDGEQIKMRIGLHT 564
            :.....:..:::.:||.|...|||..:....|.....|.|.|..|..|.....|..|.||:|:|:
  Rat   307 QIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRVATGVDINMRVGVHS 371

  Fly   565 GTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVSPTTKDWLTKHEGFE-FELQPRDP 626
            |:||.||:|.:..:|.::.|.||:||..|:|....:::::..|...|......| .:::.|||
  Rat   372 GSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAGAYAVERADMEHRDP 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 19/69 (28%)
CYCc 430..619 CDD:214485 63/208 (30%)
Guanylate_cyc 457..647 CDD:278633 54/171 (32%)
Adcy4NP_062158.2 AC_N <115..246 CDD:292831 19/68 (28%)
CYCc 219..422 CDD:214485 62/202 (31%)
Guanylate_cyc 264..430 CDD:278633 51/165 (31%)
DUF1053 479..580 CDD:283888
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..523
CYCc 824..1039 CDD:214485
Guanylate_cyc 861..1060 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.