DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and ACXE

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster


Alignment Length:374 Identity:91/374 - (24%)
Similarity:149/374 - (39%) Gaps:84/374 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 LTMKFRDIVRR----------------TYTPFLIGLNNP----PGAVDFPAIGLEIKGQMV---- 356
            ||:.|.|:...                ||..::|.:..|    .|||   .:.|.:.|..:    
  Fly   119 LTLVFADLTESIYHTYAHSWILGTFYDTYIIYMIYMFLPIHFISGAV---LLALLVSGLYILYFV 180

  Fly   357 ------HCPESNSLLFIGSPFLDGLDGLTCN--GLFISDIPLHDATREVILVGEQARAQDGLRRR 413
                  ....:::|..:|...:|.:..|..|  |:|..             |......:.....|
  Fly   181 IFIAQGFAQFASALFSVGGMSVDIVHYLCLNLVGIFYR-------------VMNDTVVRSSFLDR 232

  Fly   414 MDKIKNSIEEANSAVTKERKKNVSLLHLIFPAEIAEKL-----------------W--LGSSIDA 459
            ...||..|...|:     |.:...||..|.|.:|:..|                 |  :..::..
  Fly   233 HQYIKEKIWLRNA-----RLQEKQLLDSILPPQISLPLQKDIQGRIVMAKQGIHSWTAMERTMAI 292

  Fly   460 KTYPDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLH 524
            :.:|||:||::|:|.:|.:.:..|..|::.:|..||..||.....:.|.:::.:||.|...:||.
  Fly   293 QIHPDVSILYADVVNYTHLTTTLTVEMLVKVLHDLYGRFDLAAYRYKVQRIKFLGDCYYCVAGLS 357

  Fly   525 RASIYDAHKVAWMALKMIDACSKHITH----DGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHS 585
            ......|:....:.|.||:    ||..    .|..|.||||:|:|.:.|||:|....::.::|..
  Fly   358 DPDPDHANNCVILGLSMIN----HIMEVRDIHGLDINMRIGVHSGNLFAGVIGEAKLQFDIWGLD 418

  Fly   586 VTIANKFESGSEALKINVSPTTKDWLTKHEGFEFELQP---RDPSFLPK 631
            |||||..||......:::|..|.:.|..:. |:.|..|   ||...|.|
  Fly   419 VTIANVLESTGVPGCVHISGATLNNLDVNR-FDIEDGPEEARDHPLLKK 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 32/166 (19%)
CYCc 430..619 CDD:214485 59/211 (28%)
Guanylate_cyc 457..647 CDD:278633 57/182 (31%)
ACXENP_652601.3 AC_N <31..272 CDD:318454 33/173 (19%)
Nucleotidyl_cyc_III 290..459 CDD:325147 53/173 (31%)
Nucleotidyl_cyc_III 851..1071 CDD:325147
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453983
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.