DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and Phlpp2

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001102601.2 Gene:Phlpp2 / 498949 RGDID:1562857 Length:1359 Species:Rattus norvegicus


Alignment Length:405 Identity:89/405 - (21%)
Similarity:151/405 - (37%) Gaps:88/405 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LLLKMDEASASEILVLLGEELITCCCTGIIERAFRCLGTDLQ---EFLGSLDGVYDVLKLQEEDV 162
            |:|...|..||||....|.|.:.....|.:.|........||   ::|..| |..|.:::||| .
  Rat   100 LVLCTVETPASEICAGEGRESLYLQLHGDLVRRLEPTERPLQIVYDYLSRL-GFEDPVRIQEE-A 162

  Fly   163 TDTGFVC---------------------------AGEGELIFTSERPVI---AWLLLGSLK-ALT 196
            |:....|                           .|:.:|...:||.|:   ..|::.|:| ..|
  Rat   163 TNPDLSCMIRFYGEKPCQMDHLDRILLSGIYNVRKGKTQLHKWAERLVVLCGTCLIVSSVKDCQT 227

  Fly   197 RMLYKVD-VNIKIEPVEGDARRYRYLFSLVKDNSQTMLMGRPT---------SVSKTIPETVQRS 251
            ..::.:. |..|||.|:  .|::...||.....:||..:...|         ..||.:.:.:   
  Rat   228 GKMHILPLVGGKIEEVK--RRQHSLAFSSAGAQAQTYHVSFETLAEYQRWQRQASKVVSQRI--- 287

  Fly   252 NSSNASDLQMNSSSFCKMFPWHFIMNEQLELVQLGRGFSKLYKPYMADFGCQATTYFDFKRPKGL 316
               :..||...|   .:..|.|...::.:..:.|...|.:|.:|...|      |.:.|.:.|||
  Rat   288 ---STVDLSCYS---LEEVPEHLFYSQDITYLNLRHNFMQLERPGGLD------TLYKFSQLKGL 340

  Fly   317 TMKFRDI--------VRRTYTPFLIGLNNPPGAVDFPA-IGLEIKGQMVHCPESNSLLFIGSPFL 372
            .:....:        ...|.|...:..|   |..|.|: ||..:..|.: |.:.|.|..:... |
  Rat   341 NLSHNKLGLFPVLLCEISTLTELNLSCN---GFHDLPSQIGNLLNLQTL-CLDGNVLTALPDE-L 400

  Fly   373 DGLDGLTCNGLF---ISDIP--LHDATR--EVILVGEQARAQD-GLRRRMDKIKN---SIEEANS 426
            ..|..||..|:.   .|.||  |...|.  :|::.|.:....: |:..||:.:|:   .:....:
  Rat   401 GNLQQLTSLGISFNNFSQIPEVLEKLTMLDKVVMAGNRLEILNLGVLTRMNHVKHVDLRMNHLKT 465

  Fly   427 AVTKERKKNVSLLHL 441
            .:.:..:.|..:.|:
  Rat   466 VIIENLEGNKHITHM 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002 32/141 (23%)
HNOBA 259..451 CDD:285003 44/203 (22%)
CYCc 430..619 CDD:214485 2/12 (17%)
Guanylate_cyc 457..647 CDD:278633
Phlpp2NP_001102601.2 RA_PHLPP2 66..178 CDD:340761 22/79 (28%)
PH_PHLPP-like 185..279 CDD:270131 20/95 (21%)
PLN00113 284..>762 CDD:215061 45/217 (21%)
leucine-rich repeat 289..309 CDD:275380 5/22 (23%)
leucine-rich repeat 310..336 CDD:275380 7/31 (23%)
leucine-rich repeat 337..359 CDD:275380 3/21 (14%)
leucine-rich repeat 360..382 CDD:275380 7/24 (29%)
leucine-rich repeat 383..405 CDD:275380 6/23 (26%)
leucine-rich repeat 406..428 CDD:275380 7/21 (33%)
leucine-rich repeat 429..452 CDD:275380 5/22 (23%)
leucine-rich repeat 453..476 CDD:275380 2/22 (9%)
leucine-rich repeat 477..497 CDD:275380 1/4 (25%)
leucine-rich repeat 498..517 CDD:275380
leucine-rich repeat 518..539 CDD:275380
leucine-rich repeat 540..562 CDD:275380
leucine-rich repeat 563..584 CDD:275380
leucine-rich repeat 586..607 CDD:275380
leucine-rich repeat 608..631 CDD:275380
leucine-rich repeat 632..681 CDD:275380
leucine-rich repeat 682..705 CDD:275380
leucine-rich repeat 706..728 CDD:275380
leucine-rich repeat 751..772 CDD:275380
PP2Cc 820..1069 CDD:238083
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.