DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and NPR3

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001191304.1 Gene:NPR3 / 4883 HGNCID:7945 Length:541 Species:Homo sapiens


Alignment Length:501 Identity:95/501 - (18%)
Similarity:156/501 - (31%) Gaps:163/501 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 LKALTRMLYKVDVNIKIEPVEGDARRY------------------RYLFSLVKDNSQTMLMGRPT 238
            |.:|||:...::..::.....|..||.                  |.||||| |........:|.
Human    66 LFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLV-DRVAAARGAKPD 129

  Fly   239 SVSKTIPETVQRSNSSNAS--DLQMNS---------------SSFCKMFPWHFIMNEQLELVQLG 286
            .:...:.|......:..||  ||.|.|               |...::.|.:..|.|.:..:...
Human   130 LILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPAYAKMGEMMLALFRH 194

  Fly   287 RGFSKLYKPYMAD-------FGCQA-----------TTYFDFKRPKGLTMKFRDIVRRTYTPFLI 333
            ..:|:....|..|       |..:.           |:.:.|...|.|.::  ||||.......:
Human   195 HHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLE--DIVRNIQASERV 257

  Fly   334 GLNNPPGAVDFPAIGLEIKGQMVHCPESNSLLFIGSPFLDGLDGLTCNGLFISDIPLHDATREVI 398
                                 ::.|..|:::..|  ..:....|:|.......:|.|.::     
Human   258 ---------------------VIMCASSDTIRSI--MLVAHRHGMTSGDYAFFNIELFNS----- 294

  Fly   399 LVGEQARAQDGLRRRMDKIKNSIEEANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSSID----- 458
                 :...||..:|.||.....::|.|::     :.|:||..:.|......:.:.||::     
Human   295 -----SSYGDGSWKRGDKHDFEAKQAYSSL-----QTVTLLRTVKPEFEKFSMEVKSSVEKQGLN 349

  Fly   459 --------AKTYPDVTIL-----------------------------FSDIVGFTSICS---RAT 483
                    .:.:.|..:|                             |..|.|..||.:   |..
Human   350 MEDYVNMFVEGFHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYG 414

  Fly   484 PFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMALKM-IDACSK 547
            .|.||:|.:            .:....|.||| |....|  |..:....|..|..||: ||. ::
Human   415 DFSVIAMTD------------VEAGTQEVIGD-YFGKEG--RFEMRPNVKYPWGPLKLRIDE-NR 463

  Fly   548 HITH-DGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKF 592
            .:.| :....|...||....|...|||      .|.|..:.:|..|
Human   464 IVEHTNSSPCKSSGGLEESAVTGIVVG------ALLGAGLLMAFYF 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002 4/15 (27%)
HNOBA 259..451 CDD:285003 37/224 (17%)
CYCc 430..619 CDD:214485 43/210 (20%)
Guanylate_cyc 457..647 CDD:278633 37/183 (20%)
NPR3NP_001191304.1 PBP1_NPR_C_like 54..446 CDD:107381 77/435 (18%)
ANF_receptor 71..422 CDD:279440 66/391 (17%)
TM_EphA1 476..507 CDD:214014 10/34 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.