DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and NPR2

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_024303324.1 Gene:NPR2 / 4882 HGNCID:7944 Length:1103 Species:Homo sapiens


Alignment Length:392 Identity:137/392 - (34%)
Similarity:188/392 - (47%) Gaps:87/392 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 GLNNPPGAVDFPAIGLEIKGQMVHCPESNSLLFIGSP---------------------------- 370
            ||...|....:|| |.....::...||    |..|:|                            
Human   721 GLGGAPFRGTWPA-GFLFSEKLWTAPE----LLSGNPLPTTGMQKADVYSFGIILQEIALRSGPF 780

  Fly   371 FLDGLD-------GLTCNG---LFISDIPLHDATREVILVGEQARAQD-----------GLRRRM 414
            :|:|||       ....||   .|...|.......|::|:.|:..|||           |..||.
Human   781 YLEGLDLSPKEIVQKVRNGQRPYFRPSIDRTQLNEELVLLMERCWAQDPAERPDFGQIKGFIRRF 845

  Fly   415 DK--------------------IKNSIEEANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSSIDA 459
            :|                    ::..:||...|..:|::|..:||:.|.|..:||:|..|.::.|
Human   846 NKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQA 910

  Fly   460 KTYPDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGL- 523
            :.:..|||.||||||||::.:.:||..|:::|..||..||...|.|||||||||||||.|.||| 
Human   911 EAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLP 975

  Fly   524 HRASIYDAHKVAWMALKMIDACS----KHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGH 584
            .|.....|.::|.|||.::||.|    :|..||  |:::|||:|||.|.|||||.|||||||||.
Human   976 GRNGQRHAPEIARMALALLDAVSSFRIRHRPHD--QLRLRIGVHTGPVCAGVVGLKMPRYCLFGD 1038

  Fly   585 SVTIANKFESGSEALKINVSPTTKDWLTKHEGFEFELQPRDPSFLPKEFPNPGGTETCYFLESFR 649
            :|..|::.||..:||||:||.||||.|.:...|:.||:.      ..|....|...|.:.|...:
Human  1039 TVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRG------DVEMKGKGKMRTYWLLGERK 1097

  Fly   650 NP 651
            .|
Human  1098 GP 1099

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 40/185 (22%)
CYCc 430..619 CDD:214485 98/193 (51%)
Guanylate_cyc 457..647 CDD:278633 94/194 (48%)
NPR2XP_024303324.1 Periplasmic_Binding_Protein_Type_1 26..421 CDD:324556
PK_GC-A_B 521..848 CDD:270944 28/131 (21%)
HNOBA <857..902 CDD:311573 11/44 (25%)
CYCc 881..1065 CDD:214485 96/185 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.