DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and NPR1

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_000897.3 Gene:NPR1 / 4881 HGNCID:7943 Length:1061 Species:Homo sapiens


Alignment Length:662 Identity:185/662 - (27%)
Similarity:279/662 - (42%) Gaps:167/662 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VAKYRQNWPNIHKLKLDPQTFKSCANYDYLADIQELLLKMDEASASEILVLLGEELITCCCTGII 130
            |:..:.|||    |...|.....|.     .|.::.....|..|..|:|.|:|    :....||:
Human   436 VSGRKLNWP----LGYPPPDIPKCG-----FDNEDPACNQDHLSTLEVLALVG----SLSLLGIL 487

  Fly   131 ERAF---RCLGTDLQEFLGSLDGVYDVLKLQEEDV----------------------TDTGFVCA 170
            ..:|   |.:  .|::.|.|     ::.:::.|||                      ::.|.:..
Human   488 IVSFFIYRKM--QLEKELAS-----ELWRVRWEDVEPSSLERHLRSAGSRLTLSGRGSNYGSLLT 545

  Fly   171 GEGEL-IFTSERPVIAWLLLGSLKALTRMLYK-VDVNIKIEPVEGDARRYRYLFSL-----VKDN 228
            .||:. :|....     ...|:|.|:.|:..| :::..|:            ||.|     |::.
Human   546 TEGQFQVFAKTA-----YYKGNLVAVKRVNRKRIELTRKV------------LFELKHMRDVQNE 593

  Fly   229 SQTMLMGRPTSVSKTIPETV----QRSNSSNASDLQMNSSSFCKMFPWHFIMNEQLELVQLGRGF 289
            ..|..:|..|.     |..:    :.....:..|:..|.|.   ...|.|..:...::|   :|.
Human   594 HLTRFVGACTD-----PPNICILTEYCPRGSLQDILENESI---TLDWMFRYSLTNDIV---KGM 647

  Fly   290 SKLYKPYMADFG------CQATTYFDFKRPKGLTMKFRDI---------VRRTYT-PFLIGLNNP 338
            ..|:...:...|      |.....|..|........|||:         .::.:| |.|:.:.:|
Human   648 LFLHNGAICSHGNLKSSNCVVDGRFVLKITDYGLESFRDLDPEQGHTVYAKKLWTAPELLRMASP 712

  Fly   339 P----GAVDFPAIGLEIKGQMVHCPESNSLLFIGSPFLDGLD----------------------- 376
            |    .|.|..:.|:.::         ...|..|...::|||                       
Human   713 PVRGSQAGDVYSFGIILQ---------EIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLA 768

  Fly   377 --------GLTCNGLFISD-----------IPLHDATREVILVGEQARAQDGLRRRMDKIKNS-- 420
                    ||.....:..|           :.|....||     ..:...|.|..||::..|:  
Human   769 LQSHLEELGLLMQRCWAEDPQERPPFQQIRLTLRKFNRE-----NSSNILDNLLSRMEQYANNLE 828

  Fly   421 --IEEANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSSIDAKTYPDVTILFSDIVGFTSICSRAT 483
              :||...|..:|::|..:||:.|.|..:||:|..|.::.|:.:..|||.||||||||::.:.:|
Human   829 ELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAEST 893

  Fly   484 PFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLH-RASIYDAHKVAWMALKMIDAC-S 546
            |..|:::|..||..||...|.|||||||||||||.|.|||. |.....|.:||.|||.::||. |
Human   894 PMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRS 958

  Fly   547 KHITH-DGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVSPTTKDW 610
            ..|.| ..||:::|||:|||.|.|||||.|||||||||.:|..|::.||..|||||::|..||..
Human   959 FRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAV 1023

  Fly   611 LTKHEGFEFELQ 622
            |.:..|||.||:
Human  1024 LEEFGGFELELR 1035

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002 29/158 (18%)
HNOBA 259..451 CDD:285003 49/257 (19%)
CYCc 430..619 CDD:214485 98/191 (51%)
Guanylate_cyc 457..647 CDD:278633 91/169 (54%)
NPR1NP_000897.3 PBP1_NPR_A 36..443 CDD:107380 1/6 (17%)
ANF_receptor 54..414 CDD:279440
PK_GC-A_B 534..807 CDD:270944 50/309 (16%)
TyrKc 547..801 CDD:197581 48/290 (17%)
HNOBA <816..861 CDD:285003 15/44 (34%)
CYCc 840..1032 CDD:214485 98/191 (51%)
Guanylate_cyc 867..1053 CDD:278633 91/169 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.