DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and CG14877

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster


Alignment Length:284 Identity:57/284 - (20%)
Similarity:91/284 - (32%) Gaps:113/284 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 REVILVGEQARAQDGLRRRMDKIKNSIEEANSAVTKERKKNVSLL--HLIFPAEIAEKLWLGSSI 457
            |.::|:.:....|..|.|.:..:|         |.:::.::.||:  |:.|.       ||..  
  Fly    43 RALVLLPDDNMYQASLPRVLPILK---------VAEQQIRSKSLIPSHIDFE-------WLAH-- 89

  Fly   458 DAKTYPDVTILFSDIVGFTSICSRATPFMVISMLEGLYKD-----FDEFCDFFDVYKVETIGDAY 517
            |.|                  |..:  ..||..::|:.|.     |...|| :.:..|..| ..|
  Fly    90 DTK------------------CDAS--LGVIKAMDGIIKQCAQVIFGPVCD-YSLAAVSRI-TKY 132

  Fly   518 CVASGLHRASIYDAHKVAWMALKMIDACSKHITHDGEQIKMRIG------LHTGTVLAGVVGRKM 576
            ..:.|....|:..:                  |:|.||.|....      |.||.:         
  Fly   133 FNSQGTPLISVGGS------------------TYDFEQKKTDCNDEFYMLLRTGML--------- 170

  Fly   577 PRYCLFGHSVTIANKFESGSEALKINVSPTTKDWLTKHEGFEFELQPRDPSFLPKEFPNPGGTET 641
                          .||:.|| |.|||. ...:|  .|..|.:|   ||..      .:..|..|
  Fly   171 --------------SFETISE-LTINVM-KRHNW--SHSIFYYE---RDGQ------RSVAGMHT 208

  Fly   642 CYFL-----ESFRNPALD-SELPL 659
            |:.:     :..||..:. ::.||
  Fly   209 CFLMMKSLGKQMRNENMTFAQFPL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 11/57 (19%)
CYCc 430..619 CDD:214485 40/201 (20%)
Guanylate_cyc 457..647 CDD:278633 40/205 (20%)
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 56/281 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.