DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and Ac76E

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster


Alignment Length:353 Identity:86/353 - (24%)
Similarity:144/353 - (40%) Gaps:95/353 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   412 RRMDKIKNSIEEANSAVTKERKKNVSLLHLIFPAEIAEKLWLG---------------------- 454
            |.:|..:..||: ...:..||::...||..:.||.||.::...                      
  Fly   241 RTVDGTRTGIEQ-RVKLECEREQQEQLLLSVIPAYIAAEVKRSIMLKMADACQRAGGQASTSATR 304

  Fly   455 -SSIDAKTYPDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYC 518
             ..:..:.:.:|||||:|||.||.:.|..|...::..|..|:..||:........:::.:||.|.
  Fly   305 FHELHVQRHTNVTILFADIVNFTPLSSSLTASDLVKTLNDLFGRFDQIAQENQCLRIKILGDCYY 369

  Fly   519 VASGLHRASIYDAHKVAWMALKMIDACSKHITH-DGEQIKMRIGLHTGTVLAGVVGRKMPRYCLF 582
            ..|||..:....|.....|.|:||||. :|:.. .|..:.||||:|||.||.||:|.:..::.::
  Fly   370 CVSGLPISRPQHATNCVNMGLQMIDAI-RHVREATGINVDMRIGIHTGNVLCGVLGLRKWQFDVW 433

  Fly   583 GHSVTIANKFESGSEALKINVSPTTKDWLTKHEGFEFELQ----------------------PRD 625
            ...||:||..|||..|.:::::..|.|:|    |.:||::                      |..
  Fly   434 SDDVTLANHMESGGVAGRVHITKQTLDFL----GDKFEVEQGEGGNRDAYLADHKVESYLIVPPK 494

  Fly   626 PSF----------LPKEFPNPGGTETCYFLESFRN------------------PALDSE------ 656
            |::          :.:..|:|...||....|:.::                  ||:..|      
  Fly   495 PAYTYSVPRVVECIEQNDPSPTTEETKEIKETDQSHEATDVADVLLPVTVAPPPAIVDEKMSPTS 559

  Fly   657 ---------LPLVEHINVSMKTISEGGD 675
                     .||....::|:|.:||..|
  Fly   560 INSQEAPLHAPLASAASMSIKELSEEED 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 12/38 (32%)
CYCc 430..619 CDD:214485 63/212 (30%)
Guanylate_cyc 457..647 CDD:278633 63/222 (28%)
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 12/48 (25%)
CYCc 259..467 CDD:214485 63/212 (30%)
Guanylate_cyc 311..469 CDD:278633 57/162 (35%)
BASP1 510..667 CDD:283191 15/78 (19%)
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454043
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.