DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and CG10738

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster


Alignment Length:238 Identity:95/238 - (39%)
Similarity:134/238 - (56%) Gaps:15/238 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 PLHDATREVILVGEQARAQDGLRRRMDKIKNSIE----EANSAVTKERKKNVSLLHLIFPAEIAE 449
            ||....|..|.        |.:...|:|..|::|    :....:.:|:||..:|||.:.|..:|:
  Fly   849 PLRKGMRPNIF--------DNMMAMMEKYANNLEALVDDRTDQLQEEKKKTDALLHEMLPRCVAD 905

  Fly   450 KLWLGSSIDAKTYPDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIG 514
            :|..|..:|.:.|..|:|.||||||||::.:..||..|:..|..||..||.....:|||||||||
  Fly   906 QLKKGHKVDPEHYEQVSIYFSDIVGFTAMSAECTPLQVVDFLNDLYTCFDSIIGHYDVYKVETIG 970

  Fly   515 DAYCVASGLH-RASIYDAHKVAWMALKMIDACSK-HITH-DGEQIKMRIGLHTGTVLAGVVGRKM 576
            |||.|.|||. |.....|.::|.|:|.::.|.|: .|.| ...::.:|||:|:|.|.|||||.||
  Fly   971 DAYMVVSGLPLRNGDLHAAEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKM 1035

  Fly   577 PRYCLFGHSVTIANKFESGSEALKINVSPTTKDWLTKHEGFEF 619
            |||||||.:|..|::.||....|||:.|...:..|.:..|:.|
  Fly  1036 PRYCLFGDTVNTASRMESSGVPLKIHCSWQCRQLLDRLGGYHF 1078

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 17/65 (26%)
CYCc 430..619 CDD:214485 85/191 (45%)
Guanylate_cyc 457..647 CDD:278633 76/166 (46%)
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365
ANF_receptor 67..416 CDD:279440
PK_GC-A_B 570..853 CDD:270944 2/3 (67%)
TyrKc 597..847 CDD:197581
HNOBA <862..907 CDD:285003 12/44 (27%)
CYCc 886..1078 CDD:214485 85/191 (45%)
Guanylate_cyc 913..1099 CDD:278633 76/166 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.