DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and Ac3

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_610116.2 Gene:Ac3 / 35419 FlyBaseID:FBgn0023416 Length:1167 Species:Drosophila melanogaster


Alignment Length:350 Identity:94/350 - (26%)
Similarity:155/350 - (44%) Gaps:73/350 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 DGLTCNGLFISDIPLHDATREVI-----LVGE--QARAQDGLRRRMDKIKNSIEEANSAVTKERK 433
            |.|..|.|..:.:.:  ||..:|     .:||  |.||....::.:: :|..|||  .:..:|| 
  Fly   207 DSLLSNQLAANAVLI--ATAALIGLLYYFMGEAKQKRAFLEAKKSLE-VKMVIEE--QSAEQER- 265

  Fly   434 KNVSLLHLIFPAEIAEKLW--LGSS-------IDAKTYPDVTILFSDIVGFTSICSRATPFMVIS 489
                ||..:.|..:|.|:.  ||||       |....:.:|:||::||||||:|.|..:...::.
  Fly   266 ----LLLSVLPKHVAIKMREDLGSSSSEAFKKIYMSRHENVSILYADIVGFTAISSTYSAQDLVK 326

  Fly   490 MLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMALKMIDACSKHITHDGE 554
            ||..|:..||...:.:...:::.:||.|...||........|.....|.|.|:.|. |::.....
  Fly   327 MLNELFARFDRLAEKYQQLRIKILGDCYYCISGAPDERPDHAVLCVHMGLSMVKAI-KYVQQKAN 390

  Fly   555 Q-IKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVSPTTKDWLTKHEGFE 618
            . :.||:|:|||.||||::|::..::.::...|.:|||.||..:|.::::|..|..:|..    |
  Fly   391 SPVDMRVGIHTGAVLAGILGQRQWQFDVYSKDVELANKMESSGKAGRVHISDKTLAFLNG----E 451

  Fly   619 FELQPR--------------DPSFLPK--------------------EFPNPGGTETCYFLESFR 649
            ||::..              ...|:.|                    ..|||.|:.|....:...
  Fly   452 FEVEAAFGEKREELLRIAGLKTYFITKVVKAFASPCAKKINETQAEIAHPNPNGSTTDIVSDEDD 516

  Fly   650 NPA-LDSELPLVEHINVSMKTISEG 673
            |.| ||.|..|.::      ::|.|
  Fly   517 NDATLDDEELLAQN------SVSNG 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 22/81 (27%)
CYCc 430..619 CDD:214485 60/198 (30%)
Guanylate_cyc 457..647 CDD:278633 59/224 (26%)
Ac3NP_610116.2 AC_N <127..285 CDD:292831 24/87 (28%)
CYCc 256..453 CDD:214485 64/208 (31%)
Guanylate_cyc 294..476 CDD:278633 52/186 (28%)
CYCc 860..1071 CDD:214485
Guanylate_cyc 892..1092 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454029
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.