DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and Phlpp

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster


Alignment Length:156 Identity:35/156 - (22%)
Similarity:59/156 - (37%) Gaps:34/156 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PSNEDLNTAVTSLVAKYRQNWPNIHKLKLDPQTFKS---CANYDYLADIQELLLKMDEASASEIL 114
            |...::..|.....|.:.|..|  .||.|.......   ..||:||..::....:|:....|.:.
  Fly    27 PLPVEVTAAEEEQAATFGQTSP--QKLSLKGSQLGGSILIGNYNYLTQLEVCENEMEVLDLSSLA 89

  Fly   115 VLLGEELITCCCTGIIERAFRCLGTDLQEFLGSLDGVYDV---------LKLQEEDVTDTGFVCA 170
            .|   |.:.|....::|....  ||:||..:...:.::::         ||||..|::...|   
  Fly    90 QL---ETLKCSRNKLMELIIN--GTNLQTLVADHNYLHNISTTNTHPVPLKLQRIDISHNNF--- 146

  Fly   171 GEGELIFTSERPVIAWLLLGSLKALT 196
                    ||.|  .|  :|:..:||
  Fly   147 --------SELP--NW--VGACASLT 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002 30/133 (23%)
HNOBA 259..451 CDD:285003
CYCc 430..619 CDD:214485
Guanylate_cyc 457..647 CDD:278633
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 5/23 (22%)
LRR_8 109..169 CDD:290566 16/67 (24%)
leucine-rich repeat 111..135 CDD:275380 2/23 (9%)
leucine-rich repeat 136..158 CDD:275380 9/36 (25%)
leucine-rich repeat 159..183 CDD:275380 2/2 (100%)
leucine-rich repeat 184..209 CDD:275380
LRR_8 205..266 CDD:290566
leucine-rich repeat 210..230 CDD:275380
leucine-rich repeat 232..255 CDD:275380
LRR_RI <256..410 CDD:238064
leucine-rich repeat 256..276 CDD:275380
LRR_8 279..359 CDD:290566
leucine-rich repeat 280..303 CDD:275380
leucine-rich repeat 304..348 CDD:275380
leucine-rich repeat 349..372 CDD:275380
PP2Cc 461..655 CDD:294085
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.