DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and rut

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster


Alignment Length:283 Identity:81/283 - (28%)
Similarity:132/283 - (46%) Gaps:36/283 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 PESNSLLFIGSPFLDGLDGLTCNGLFISDIPLHDATREVILVGEQA----------RAQDGLRRR 413
            |..:..|.:...|.|.|..|..|.| |::|        ||.:|...          |||   ||.
  Fly   162 PSVHISLTVYKIFTDALRYLEYNQL-IANI--------VIFIGVNVAGLVVNIMMERAQ---RRT 214

  Fly   414 MDKIKNSIEEANSAVTKERKKNVSLLHLIFPAEIAEKL-------WLGS--SIDAKTYPDVTILF 469
            ....:|.| .:...:..|.:|...||..:.|..:|.::       ..|.  .|..:.:.:|:|||
  Fly   215 FLDTRNCI-ASRLEIQDENEKLERLLLSVLPQHVAMQMKNDILSPVAGQFHRIYIQKHENVSILF 278

  Fly   470 SDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKV 534
            :||||||.:.|:.:...::.:|..|:..||:........:::.:||.|...|||.......|...
  Fly   279 ADIVGFTVLSSQCSAQELVRLLNELFGRFDQLAHDNHCLRIKILGDCYYCVSGLPEPRKDHAKCA 343

  Fly   535 AWMALKMIDACSKHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEAL 599
            ..|.|.||||.:..:......:.||:|:|||.||.||:|.:..::.::.:.||:||..|||.|..
  Fly   344 VEMGLDMIDAIATVVEATDVILNMRVGIHTGRVLCGVLGLRKWQFDVWSNDVTLANHMESGGEPG 408

  Fly   600 KINVSPTTKDWLTKHEGFEFELQ 622
            :::|:..|.|.|:.    |:|::
  Fly   409 RVHVTRATLDSLSG----EYEVE 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 26/101 (26%)
CYCc 430..619 CDD:214485 59/197 (30%)
Guanylate_cyc 457..647 CDD:278633 54/166 (33%)
rutNP_511156.2 AC_N <17..255 CDD:292831 26/105 (25%)
CYCc 230..425 CDD:214485 60/198 (30%)
Guanylate_cyc 266..438 CDD:278633 54/166 (33%)
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310
CYCc 924..1134 CDD:214485
Guanylate_cyc 954..1151 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.