DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and CG32305

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster


Alignment Length:295 Identity:77/295 - (26%)
Similarity:134/295 - (45%) Gaps:49/295 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 EVILVGEQARAQDGLRRRMDKIKNSIEEANSAVTKERKKNVSLLHLIFPAEIA-EKLWLGSSIDA 459
            ::::..|....:..|.|:|  |:...||..|.: :::.||.:      |::.. .||:|      
  Fly   242 QLVMKKENGLLESILPRKM--IRTLQEEICSRI-EDQDKNFT------PSKAGLRKLFL------ 291

  Fly   460 KTYPDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLH 524
            :.||:|:||.:|:|.:|.:.:......::.:|..|:.:||...:.....:::.:||:|...:|: 
  Fly   292 EPYPNVSILVADMVNYTHLTTTLEAPQLVEILHDLFVNFDLAANRNRAMRIKFLGDSYNCVAGI- 355

  Fly   525 RASIYDAHKVAWM--ALKMIDACSKHITHDGE-----QIKMRIGLHTGTVLAGVVGRKMPRYCLF 582
             .:.:.||....:  ||:||     |||....     .|.:|||:|:|.|.||::|....::.::
  Fly   356 -PNYFPAHASCCVDQALEMI-----HITQGVSSRRELDINLRIGVHSGEVFAGIIGHTKWQFDIW 414

  Fly   583 GHSVTIANKFESGSEALKINVSPTTKDWLTKHEGFE--FELQPRDPSFLPKEFPNPGGTETCYFL 645
            ...|.|.|:.||......::||..|...|.:|..|.  .|....||..      ...|..|  ||
  Fly   415 SKDVDITNRLESSGLPGLVHVSQRTLSMLDEHYIFREGTEAAKNDPIL------QQAGIRT--FL 471

  Fly   646 ESFRNP------ALDSELPLVEHINVSMKTISEGG 674
            .|.|.|      .||.||   ...:::...:|.||
  Fly   472 VSNRLPDAVEPGELDDEL---SSASINSCRLSYGG 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 11/55 (20%)
CYCc 430..619 CDD:214485 52/198 (26%)
Guanylate_cyc 457..647 CDD:278633 53/198 (27%)
CG32305NP_728725.2 CYCc 251..449 CDD:214485 58/219 (26%)
Nucleotidyl_cyc_III 292..445 CDD:299850 44/159 (28%)
CYCc 814..1056 CDD:214485
Nucleotidyl_cyc_III 845..1081 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453924
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.