DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and Npr3

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_006232107.1 Gene:Npr3 / 25339 RGDID:3196 Length:652 Species:Rattus norvegicus


Alignment Length:195 Identity:47/195 - (24%)
Similarity:73/195 - (37%) Gaps:47/195 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 KIKNSIEEANSAVTKERKKN-------------VSLLHLIFPAEIAEKLWLGSSIDAKTYPDVTI 467
            ::|:|:|:  ..:.:|...|             |..||.:..|..::|  .|..|..:|:   ..
  Rat   449 EVKSSVEK--QGLNEEDYVNMFVEGFHDAILLYVLALHEVLRAGYSKK--DGGKIIQQTW---NR 506

  Fly   468 LFSDIVGFTSICS---RATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIY 529
            .|..|.|..||.:   |...|.|::|.:            .:....|.||| |....|  |..:.
  Rat   507 TFEGIAGQVSIDANGDRYGDFSVVAMTD------------TEAGTQEVIGD-YFGKEG--RFKMR 556

  Fly   530 DAHKVAWMALKM-IDACSKHITH-DGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKF 592
            ...|..|.:||: ||. ::.:.| :....|...||....|...|||      .|.|..:.:|..|
  Rat   557 SNVKYPWGSLKLRIDE-TRIVEHTNSSPCKSSGGLEESAVTGIVVG------ALLGAGLLMAFYF 614

  Fly   593  592
              Rat   615  614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 9/47 (19%)
CYCc 430..619 CDD:214485 44/181 (24%)
Guanylate_cyc 457..647 CDD:278633 36/141 (26%)
Npr3XP_006232107.1 PBP1_NPR_C_like 165..556 CDD:107381 29/128 (23%)
ANF_receptor 182..535 CDD:279440 22/104 (21%)
TM_EphA1 587..618 CDD:214014 10/34 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.