Sequence 1: | NP_477088.2 | Gene: | Gycalpha99B / 43493 | FlyBaseID: | FBgn0013972 | Length: | 676 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006232107.1 | Gene: | Npr3 / 25339 | RGDID: | 3196 | Length: | 652 | Species: | Rattus norvegicus |
Alignment Length: | 195 | Identity: | 47/195 - (24%) |
---|---|---|---|
Similarity: | 73/195 - (37%) | Gaps: | 47/195 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 416 KIKNSIEEANSAVTKERKKN-------------VSLLHLIFPAEIAEKLWLGSSIDAKTYPDVTI 467
Fly 468 LFSDIVGFTSICS---RATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIY 529
Fly 530 DAHKVAWMALKM-IDACSKHITH-DGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKF 592
Fly 593 592 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gycalpha99B | NP_477088.2 | HNOB | 76..208 | CDD:285002 | |
HNOBA | 259..451 | CDD:285003 | 9/47 (19%) | ||
CYCc | 430..619 | CDD:214485 | 44/181 (24%) | ||
Guanylate_cyc | 457..647 | CDD:278633 | 36/141 (26%) | ||
Npr3 | XP_006232107.1 | PBP1_NPR_C_like | 165..556 | CDD:107381 | 29/128 (23%) |
ANF_receptor | 182..535 | CDD:279440 | 22/104 (21%) | ||
TM_EphA1 | 587..618 | CDD:214014 | 10/34 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |