| Sequence 1: | NP_477088.2 | Gene: | Gycalpha99B / 43493 | FlyBaseID: | FBgn0013972 | Length: | 676 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_620611.2 | Gene: | Gucy2g / 245708 | RGDID: | 621853 | Length: | 1103 | Species: | Rattus norvegicus |
| Alignment Length: | 250 | Identity: | 98/250 - (39%) |
|---|---|---|---|
| Similarity: | 136/250 - (54%) | Gaps: | 34/250 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 417 IKNSIEEANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSSIDAKTYPDVTILFSDIVGFTSICSR 481
Fly 482 ATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLH-RASIYDAHKVAWMALKMIDAC 545
Fly 546 SK-HITH-DGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVSPTTK 608
Fly 609 D---------------------------WLTKHEGFEFELQPRDPSFLPKEFPNP 636 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Gycalpha99B | NP_477088.2 | HNOB | 76..208 | CDD:285002 | |
| HNOBA | 259..451 | CDD:285003 | 8/33 (24%) | ||
| CYCc | 430..619 | CDD:214485 | 91/218 (42%) | ||
| Guanylate_cyc | 457..647 | CDD:278633 | 86/209 (41%) | ||
| Gucy2g | NP_620611.2 | PBP1_GC_G_like | 50..439 | CDD:107367 | |
| ANF_receptor | 66..417 | CDD:279440 | |||
| PK_GC | 558..832 | CDD:270894 | |||
| CYCc | 868..1058 | CDD:214485 | 86/189 (46%) | ||
| Guanylate_cyc | 895..1081 | CDD:278633 | 79/185 (43%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.810 | |||||