DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and Adcy2

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_705762.2 Gene:Adcy2 / 210044 MGIID:99676 Length:1095 Species:Mus musculus


Alignment Length:350 Identity:93/350 - (26%)
Similarity:151/350 - (43%) Gaps:72/350 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 LTMKFRDIVRRTYTPFLIGLNNPPGAVDFPAIGLEIKGQMVHCPESNSLLFIGSPFLDGLDGLTC 380
            ||.....||...|      |:..|||.:      .:..|::    :|.::||            |
Mouse   168 LTSSSHTIVLSVY------LSATPGAKE------HLFWQIL----ANVIIFI------------C 204

  Fly   381 NGLFISDIPLHDATREVILVGEQARAQDGLRRRMDKIKNSIEEANSAVTKERKKNVSLLHLIFPA 445
            ..|..:   .|....|:.|       |...|...:.||:.|:     :..|:::...||..:.||
Mouse   205 GNLAGA---YHKHLMELAL-------QQTYRDTCNCIKSRIK-----LEFEKRQQERLLLSLLPA 254

  Fly   446 EIAEKLWLG-------------------SSIDAKTYPDVTILFSDIVGFTSICSRATPFMVISML 491
            .||.::...                   .::..|.:.:|:||::||||||.:.|..:|..::.||
Mouse   255 HIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADIVGFTRLASDCSPGELVHML 319

  Fly   492 EGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMALKMIDACSKHITHDGEQI 556
            ..|:..||:.....:..:::.:||.|...|||..:....|.....|.|.|.:|..|.....|..|
Mouse   320 NELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCVKMGLDMCEAIKKVRDATGVDI 384

  Fly   557 KMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVSPTTKDWLT---KHEGFE 618
            .||:|:|:|.||.||:|.:..:|.::.|.||:||..|:|....::::|..|.:.|.   |.|..:
Mouse   385 NMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHISSVTLEHLNGAYKVEEGD 449

  Fly   619 FELQPRDP---SFLPKEF--PNPGG 638
            .|:  |||   ..|.|.:  .||.|
Mouse   450 GEI--RDPYLKQHLVKTYFVINPKG 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 30/134 (22%)
CYCc 430..619 CDD:214485 61/210 (29%)
Guanylate_cyc 457..647 CDD:278633 62/189 (33%)
Adcy2NP_705762.2 AC_N <37..264 CDD:292831 30/138 (22%)
CYCc 240..443 CDD:214485 59/202 (29%)
Guanylate_cyc 285..469 CDD:278633 60/185 (32%)
DUF1053 499..603 CDD:283888
CYCc 852..1060 CDD:214485
Guanylate_cyc 882..1081 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.