DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and ADCY4

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001185497.1 Gene:ADCY4 / 196883 HGNCID:235 Length:1077 Species:Homo sapiens


Alignment Length:291 Identity:81/291 - (27%)
Similarity:126/291 - (43%) Gaps:57/291 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 SNSLLFIGSPFLDGLDGLTCN---GLFISDIPLHDATREVILVGEQARAQDGL--RRRMDKIKNS 420
            :|::||:            |.   |::      |.|..|..|......|...|  |||:|     
Human   176 ANAVLFL------------CGNVAGVY------HKALMERALRATFREALSSLHSRRRLD----- 217

  Fly   421 IEEANSAVTKERKKNVSLLHLIFP--------AEIAEKLWLGS-----------SIDAKTYPDVT 466
                     .|:|....||..|.|        |||..:|..|.           |:..|.:..|:
Human   218 ---------TEKKHQEHLLLSILPAYLAREMKAEIMARLQAGQGSRPESTNNFHSLYVKRHQGVS 273

  Fly   467 ILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDA 531
            :|::||||||.:.|..:|..::.||..|:..||:.....:..:::.:||.|...|||..:....|
Human   274 VLYADIVGFTRLASECSPKELVLMLNELFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHA 338

  Fly   532 HKVAWMALKMIDACSKHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGS 596
            .....|.|.|..|..|.....|..|.||:|:|:|:||.||:|.:..:|.::.|.||:||..|:|.
Human   339 INCVRMGLDMCRAIRKLRAATGVDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGG 403

  Fly   597 EALKINVSPTTKDWLTKHEGFE-FELQPRDP 626
            ...:::::..|...|......| ..::.|||
Human   404 VPGRVHITGATLALLAGAYAVEDAGMEHRDP 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 24/102 (24%)
CYCc 430..619 CDD:214485 63/208 (30%)
Guanylate_cyc 457..647 CDD:278633 54/171 (32%)
ADCY4NP_001185497.1 AC_N <115..246 CDD:292831 24/101 (24%)
CYCc 219..422 CDD:214485 62/202 (31%)
Guanylate_cyc 264..418 CDD:278633 49/153 (32%)
DUF1053 479..583 CDD:283888
CYCc 827..1042 CDD:214485
Guanylate_cyc 864..1063 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.