DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and gcy-21

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001364740.1 Gene:gcy-21 / 191651 WormBaseID:WBGene00001546 Length:1163 Species:Caenorhabditis elegans


Alignment Length:245 Identity:92/245 - (37%)
Similarity:141/245 - (57%) Gaps:19/245 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 LHDATREV--ILVGEQARAQDG----LRRRMDKIKNSIEEANSAVTKERKKNVSLLHLIFPAEIA 448
            ||...|::  :.:|.:....|.    :.:..||::..|.|.|..:..|:.|:.:||.::.|..:|
 Worm   871 LHQIKRKLKPLTIGLKRTIMDNMVSMIEKYTDKLEKDIAERNEELEGEKAKSEALLKMMLPEVVA 935

  Fly   449 EKLWLGSSIDAKTYPDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETI 513
            :.|.|||::.|:::.:.|:.|||..||..:.:.:.|..::..|..||..||...|.|||||||||
 Worm   936 DSLKLGSNVSAESFENCTVFFSDCPGFVEMSATSKPIDIVQFLNDLYTVFDRIIDQFDVYKVETI 1000

  Fly   514 GDAYCVASGL------HRASIYDAHKVAWMALKMIDAC-SKHITH-DGEQIKMRIGLHTGTVLAG 570
            .|||.|||||      |.|.     ::|.:.|.::.|. |..|.| ..|::::|||:::|..:||
 Worm  1001 ADAYMVASGLPVPNGNHHAG-----EIASLGLALLKAVESFKIRHLPNEKVRLRIGMNSGPCVAG 1060

  Fly   571 VVGRKMPRYCLFGHSVTIANKFESGSEALKINVSPTTKDWLTKHEGFEFE 620
            |||.|||||||||.:|..|::.||....|:||.|.|.|:.|.:..|:|.|
 Worm  1061 VVGLKMPRYCLFGDTVNTASRMESNGIPLRINCSGTAKEILDQLGGYEIE 1110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 16/66 (24%)
CYCc 430..619 CDD:214485 80/196 (41%)
Guanylate_cyc 457..647 CDD:278633 72/172 (42%)
gcy-21NP_001364740.1 Periplasmic_Binding_Protein_type1 58..422 CDD:415822
PK_GC 612..881 CDD:270894 3/9 (33%)
HNOBA <890..938 CDD:400168 12/47 (26%)
Guanylate_cyc 944..1130 CDD:306677 72/172 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.