DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and gcy-9

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_509897.3 Gene:gcy-9 / 191645 WormBaseID:WBGene00001536 Length:1081 Species:Caenorhabditis elegans


Alignment Length:210 Identity:80/210 - (38%)
Similarity:117/210 - (55%) Gaps:19/210 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 DGLRRRMDK----IKNSIEEANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSSIDAKTYPDVTIL 468
            |.:.:.|::    ::|.:.:..:.:.:.:|:...||:.:.|..|||.|.:|..:..:.|...|:|
 Worm   836 DQMMKMMEEYTANLENMVRDRTALLEEAQKQADRLLNSMLPKSIAEDLKIGKPVLPQLYSCATVL 900

  Fly   469 FSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGL-------HRA 526
            ||||.|||.|.|.:||..|::.|..::..||......|.||||||||||.:.||:       |  
 Worm   901 FSDIRGFTRISSTSTPLQVVTFLNDMFSGFDAIIAKHDAYKVETIGDAYMIVSGVPTENGNSH-- 963

  Fly   527 SIYDAHKVAWMALKM-IDACSKHITHDGEQIKM-RIGLHTGTVLAGVVGRKMPRYCLFGHSVTIA 589
                |..:|.:|||| ...|:..:.|..|::.| |||.|:|.|.|||||...|||||||.:|..|
 Worm   964 ----AQNIADVALKMRAFICNFKLAHRPEELMMVRIGFHSGPVAAGVVGLAAPRYCLFGDTVNTA 1024

  Fly   590 NKFESGSEALKINVS 604
            ::.||...|.||.:|
 Worm  1025 SRMESTGVANKIQIS 1039

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 10/46 (22%)
CYCc 430..619 CDD:214485 77/184 (42%)
Guanylate_cyc 457..647 CDD:278633 68/157 (43%)
gcy-9NP_509897.3 Periplasmic_Binding_Protein_Type_1 66..416 CDD:299141
ANF_receptor 69..404 CDD:279440
PKc_like 550..820 CDD:304357
HNOBA <837..883 CDD:285003 9/45 (20%)
CYCc 862..1054 CDD:214485 77/184 (42%)
Guanylate_cyc 889..1076 CDD:278633 68/157 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.