DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and gcy-6

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001294696.1 Gene:gcy-6 / 191644 WormBaseID:WBGene00001533 Length:1086 Species:Caenorhabditis elegans


Alignment Length:241 Identity:93/241 - (38%)
Similarity:142/241 - (58%) Gaps:18/241 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   400 VGEQARAQDGLR--RRMDKIKNSIE-----------EANSAVTKERKKNVSLLHLIFPAEIAEKL 451
            |..|.|:.:..|  ..||.:.|.:|           |....:.:|:||:..||:.:.|.::|:||
 Worm   815 VASQLRSMNTNRNDNLMDHVFNVLESYASTLEDEVAERMKELVEEKKKSDVLLYRMLPRQVADKL 879

  Fly   452 WLGSSIDAKTYPDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDA 516
            .||.:::.:|:..||:.|||:|.||::..:.||..|:::|.|||..||...:..||||||||||.
 Worm   880 KLGQTVEPETFDIVTLFFSDVVSFTTLAGKCTPLQVVNLLNGLYTIFDGIIEQHDVYKVETIGDG 944

  Fly   517 YCVASGLHRASIYD-AHKVAWMALKMIDACSK-HITH-DGEQIKMRIGLHTGTVLAGVVGRKMPR 578
            |.||||:.|.:..: ...:|.|::..:.:.:. .|.| .||:||:|:|.|.|:|:|||||..|||
 Worm   945 YFVASGVPRRNGNEHTRNIASMSINFVKSLADFSIPHLPGEKIKIRVGFHCGSVVAGVVGLTMPR 1009

  Fly   579 YCLFGHSVTIANKFESGSEALKINVSPTTKDWLTKHEGFEFELQPR 624
            |||||.:|..|::.||.|:..:|::|......|.:..||..|  ||
 Worm  1010 YCLFGDAVNTASRMESNSKPGQIHLSEEANQMLMRLGGFTTE--PR 1053

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 16/63 (25%)
CYCc 430..619 CDD:214485 81/191 (42%)
Guanylate_cyc 457..647 CDD:278633 73/171 (43%)
gcy-6NP_001294696.1 PBP1_NPR_GC_like 29..445 CDD:107347
ANF_receptor 57..424 CDD:279440
PKc_like 585..822 CDD:304357 3/6 (50%)
HNOBA <847..879 CDD:285003 8/31 (26%)
CYCc 858..1048 CDD:214485 79/189 (42%)
Guanylate_cyc 885..1070 CDD:278633 73/171 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.