DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and gcy-5

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_496219.1 Gene:gcy-5 / 191643 WormBaseID:WBGene00001532 Length:1122 Species:Caenorhabditis elegans


Alignment Length:226 Identity:85/226 - (37%)
Similarity:132/226 - (58%) Gaps:16/226 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 MDKIKNSIEEANSA-----------VTKERKKNVSLLHLIFPAEIAEKLWLGSSIDAKTYPDVTI 467
            ||.:.|.:||..|.           :|.|:||...||..:.|.::||:|..|.:::.:.:..||:
 Worm   825 MDHVFNMLEEYTSTLEVDIEERTKELTLEKKKADILLSRMLPKQVAERLKAGQTVEPEGFDTVTV 889

  Fly   468 LFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAH 532
            ||||:|.||.:.::.:||.|:::|..||.:||...:...|||||:|||.|...|||...:.| ||
 Worm   890 LFSDVVKFTQLAAKCSPFQVVNLLNDLYSNFDTIIEEHGVYKVESIGDGYLCVSGLPTKNGY-AH 953

  Fly   533 --KVAWMALKMIDAC-SKHITH-DGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFE 593
              ::..|:||.:|.| |..:.| ..|::::|||:::|..:|||||..||||||||.:|..|::.|
 Worm   954 IKQIVDMSLKFMDYCKSFKVPHLPREKVELRIGINSGPCVAGVVGLSMPRYCLFGDTVNTASRME 1018

  Fly   594 SGSEALKINVSPTTKDWLTKHEGFEFELQPR 624
            |..:...|::|......||.|...::|...|
 Worm  1019 SNGKPSMIHMSEAAHSLLTDHYPHQYETSSR 1049

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 15/47 (32%)
CYCc 430..619 CDD:214485 76/192 (40%)
Guanylate_cyc 457..647 CDD:278633 68/172 (40%)
gcy-5NP_496219.1 PBP1_NPR_GC_like 30..440 CDD:107347
ANF_receptor 49..426 CDD:279440
PK_GC 546..816 CDD:270894
HNOBA <830..873 CDD:285003 13/42 (31%)
CYCc 852..1042 CDD:214485 76/190 (40%)
Guanylate_cyc 879..1067 CDD:278633 68/172 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.