DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and gcy-3

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_496037.1 Gene:gcy-3 / 191641 WormBaseID:WBGene00001530 Length:1140 Species:Caenorhabditis elegans


Alignment Length:280 Identity:92/280 - (32%)
Similarity:142/280 - (50%) Gaps:48/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 ISDIPLHDATREVILVGEQARAQ------------DGLRRRMDKIKNS----------------- 420
            |:|:|  |....:|.:.:...|:            :.||..|.|.|::                 
 Worm   787 ITDVP--DVNPTLIALVKDCWAEAPEDRPTAENICEQLRDLMPKTKSNLMDHVFNMLEEYTSTLE 849

  Fly   421 --IEEANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSSIDAKTYPDVTILFSDIVGFTSICSRAT 483
              :||....:|.|:||...||..:.|.::||:|..|.:::.:.:..||:.|||:|.||.:.|:.|
 Worm   850 VEVEERTKELTLEKKKADLLLSRMLPKQVAERLKAGQTVEPEGFDSVTVFFSDVVKFTILASKCT 914

  Fly   484 PFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGL-------HRASIYDAHKVAWMALKM 541
            ||.|:::|..||.:||...:...|||||:|||.|...|||       |...|.|      |:||.
 Worm   915 PFQVVNLLNDLYSNFDTIIEEHGVYKVESIGDGYLCVSGLPTRNGFNHIKQIVD------MSLKF 973

  Fly   542 IDACSK-HITH-DGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVS 604
            :|.|.. .|.| ..|::::|||:::|..:|||||..||||||||.:|..|::.||..:...|:::
 Worm   974 MDYCKNFKIPHLPRERVELRIGVNSGPCVAGVVGLSMPRYCLFGDTVNTASRMESNGKPSLIHLT 1038

  Fly   605 PTTKDWLTKHEGFEFELQPR 624
            ......|.||...::|...|
 Worm  1039 SDAHLLLMKHFPHQYETNSR 1058

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 22/96 (23%)
CYCc 430..619 CDD:214485 76/197 (39%)
Guanylate_cyc 457..647 CDD:278633 68/177 (38%)
gcy-3NP_496037.1 PBP1_NPR_GC_like 36..453 CDD:107347
ANF_receptor 54..433 CDD:279440
PKc_like 554..823 CDD:304357 6/37 (16%)
HNOBA <839..882 CDD:285003 11/42 (26%)
CYCc 861..1051 CDD:214485 76/195 (39%)
Guanylate_cyc 888..1076 CDD:278633 68/177 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.