DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and gcy-1

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_496039.1 Gene:gcy-1 / 191639 WormBaseID:WBGene00001528 Length:1137 Species:Caenorhabditis elegans


Alignment Length:284 Identity:95/284 - (33%)
Similarity:148/284 - (52%) Gaps:44/284 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 GLF------ISDIPLHDATREVILVGEQARAQ---------------DGLRRR-----MDKIKNS 420
            |||      |:||  ||....:|.:.:...|:               .||..:     ||.:.|.
 Worm   779 GLFPIRPEIITDI--HDVNPALIALVKDCWAEVPEDRPTAENICSQMKGLVSKQKTNLMDHVFNM 841

  Fly   421 IEEANSA-----------VTKERKKNVSLLHLIFPAEIAEKLWLGSSIDAKTYPDVTILFSDIVG 474
            :||..|.           :|.|:||...||..:.|.::||:|..|.:::.:.:..||:.|||:|.
 Worm   842 LEEYTSTLEEEIEERTKELTLEKKKADILLSRMLPKQVAERLKAGQTVEPEGFDSVTVFFSDVVK 906

  Fly   475 FTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAH--KVAWM 537
            ||.:.|:.:||..:::|..||.:||...:...|||||:|||.|...|||...:.| ||  ::..|
 Worm   907 FTILASKCSPFQTVNLLNDLYSNFDTIIEQHGVYKVESIGDGYLCVSGLPTRNGY-AHIKQIVDM 970

  Fly   538 ALKMIDAC-SKHITH-DGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALK 600
            :||.::.| |.:|.| ..|.:::|||:::|..:|||||..||||||||.:|..|::.||..:...
 Worm   971 SLKFMEYCKSFNIPHLPRENVELRIGVNSGPCVAGVVGLSMPRYCLFGDTVNTASRMESNGKPSL 1035

  Fly   601 INVSPTTKDWLTKHEGFEFELQPR 624
            |:::......||.|...::|...|
 Worm  1036 IHLTNDAHSLLTTHYPNQYETSSR 1059

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 27/105 (26%)
CYCc 430..619 CDD:214485 74/192 (39%)
Guanylate_cyc 457..647 CDD:278633 66/172 (38%)
gcy-1NP_496039.1 PBP1_NPR_GC_like 35..449 CDD:107347
ANF_receptor 53..432 CDD:279440
PKc_like 555..821 CDD:304357 10/43 (23%)
HNOBA <840..883 CDD:285003 13/42 (31%)
CYCc 862..1051 CDD:214485 74/189 (39%)
Guanylate_cyc 889..1077 CDD:278633 66/172 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.