DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and acy-2

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_504553.1 Gene:acy-2 / 191607 WormBaseID:WBGene00000069 Length:1080 Species:Caenorhabditis elegans


Alignment Length:286 Identity:74/286 - (25%)
Similarity:129/286 - (45%) Gaps:45/286 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 SNSLLFIGSPFLDGLDGLTCNGLFIS---DIPLHDATREVILVGEQARAQDGLRRRMDKIKNSIE 422
            :|.||.:...:    |.|..|.||:.   .:.||...  :.|||..|.:.:...|.  :|...:.
 Worm   184 ANFLLIVAINW----DALNVNTLFMCSCLSLFLHQGV--IALVGVVADSNEAGNRA--EIARKLT 240

  Fly   423 EA-----NSAVTKERKKNVSLLHLIFPAEIAEKL--------WLGSSID---------------- 458
            ||     .....|:|::  .||..:.||.:|:::        ..||:::                
 Worm   241 EAVYRRTELETLKDRQE--QLLLSVIPAYLADQVSKSIIQSSSTGSTVEVPRTGKNNTKNHKLFH 303

  Fly   459 ---AKTYPDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVA 520
               .:.:.:|:|||:|||.||.:.::.|...::..|..||..||.........:::.:||.|...
 Worm   304 DLHVQVHDNVSILFADIVNFTVLAAQLTAKDLVRTLNELYSKFDRDAQRLQCMRIKFLGDCYYCV 368

  Fly   521 SGLHRASIYDAHKVAWMALKMIDACSKHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHS 585
            ||:.......|.....|.|:||:...:.....|..:.||||:|||:||.|::|.:..::.::...
 Worm   369 SGMPVNRPNHADMCVVMGLEMINTIKQVRIATGVDVNMRIGVHTGSVLCGIMGLRKWQFDIWSDD 433

  Fly   586 VTIANKFESGSEALKINVSPTTKDWL 611
            ||:||..||......::::.:|||.|
 Worm   434 VTLANHMESAGVPGAVHITKSTKDML 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 25/97 (26%)
CYCc 430..619 CDD:214485 56/209 (27%)
Guanylate_cyc 457..647 CDD:278633 47/174 (27%)
acy-2NP_504553.1 CYCc 253..463 CDD:214485 56/209 (27%)
Guanylate_cyc 308..459 CDD:278633 46/150 (31%)
CYCc 817..1034 CDD:214485
Guanylate_cyc 840..1054 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.