DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and gcy-29

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001364597.1 Gene:gcy-29 / 175116 WormBaseID:WBGene00007314 Length:1069 Species:Caenorhabditis elegans


Alignment Length:257 Identity:90/257 - (35%)
Similarity:134/257 - (52%) Gaps:24/257 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 SDIP-LHDATREVILVGE-----QARAQDGLRRRMDKIKNSIEEANSAVTK-ERKKNVSLLHLIF 443
            ||.| :....|.|.|..|     :....|.:.|.|::..|::|:.....|| ..:.|:....|:|
 Worm   786 SDQPDMRPTIRRVRLATEIALKTKGNLVDSMMRMMEEYANNLEKLVGERTKLAEEANLRAERLLF 850

  Fly   444 ---PAEIAEKLWLGSSIDAKTYPDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFF 505
               |..:|.:|..|.::..|.|...|::||||||||.:||.:||..|:::|..||.:||......
 Worm   851 QLLPKHVAIELKAGRTVAPKMYDSATVMFSDIVGFTKLCSASTPIEVVNLLNKLYSEFDTVISKH 915

  Fly   506 DVYKVETIGDAYCVASGL-------HRASIYDAHKVAWMALKMIDACSKHITHDGE-QIKMRIGL 562
            |.||||||||||.|.||:       |.|:|..........||:.:     :.|..: ::.:|:|.
 Worm   916 DCYKVETIGDAYMVVSGIPIENGQRHVANISAVTLGIMDLLKVFE-----VPHRRDYRLTIRLGF 975

  Fly   563 HTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVSPTTKDWLTKHEGFEFELQPR 624
            .:|.|.|.|||...|||||||.:|.||...||..|..::.::.|:| .|.::|..||.::.|
 Worm   976 ASGQVSAAVVGLSSPRYCLFGETVNIAAVMESSGEGGRVQITETSK-ILLENEYPEFIIEIR 1036

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 19/74 (26%)
CYCc 430..619 CDD:214485 74/200 (37%)
Guanylate_cyc 457..647 CDD:278633 69/176 (39%)
gcy-29NP_001364597.1 PBP1_NPR_GC-like 27..403 CDD:380575
PKc_like 534..804 CDD:419665 6/17 (35%)
CYCc 840..1033 CDD:214485 75/198 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.