DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and gcy-12

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_494995.2 Gene:gcy-12 / 173902 WormBaseID:WBGene00001538 Length:1679 Species:Caenorhabditis elegans


Alignment Length:596 Identity:149/596 - (25%)
Similarity:240/596 - (40%) Gaps:173/596 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 RAFRCLG-TDLQEFLGSLDGVYDVLKLQEEDVTDTGFVCAGEGELIFTSERPVIAWLLLGSLKAL 195
            ||.|.|. .::..|||.:...|.|..::|        .|:                  .|||..:
 Worm   716 RAMRQLAHPNVNNFLGIIVCQYSVTVVRE--------YCS------------------KGSLHDI 754

  Fly   196 TRMLYKVDVNIKIEPVEGDARRYRYLFSLVKDNSQTMLMGRPTSVSKTIPETVQRSNSSNASDLQ 260
            .|     :.|:|::        :.|:.|.|.|..:.|:.                   .:.|:|:
 Worm   755 LR-----NENLKLD--------HMYVASFVDDLVKGMVY-------------------IHDSELK 787

  Fly   261 MN---SSSFCKMFPWHFIMNEQLELVQLGRGFSKLYKPYMADFGCQATTYFDFKRPKGLTMKFRD 322
            |:   .|:.|       ::..:..|.....|..:|.:..|.|........|.:..|:.:|:... 
 Worm   788 MHGNLKSTNC-------LITSRWTLQIADFGLRELREGIMYDSSYNIWENFLWTAPEAMTINGS- 844

  Fly   323 IVRRTYTPFLIGLNNPP----GAVDFPAIGLEIKGQMVHCPESNSLLFIGSPFLDG-----LDGL 378
                      :.::|||    .|..|..|..||     ...|....:::....::|     .|.:
 Worm   845 ----------LAISNPPTPKADAYSFGIIFHEI-----FTREGPYKIYVQRGDVNGEAAPKKDSV 894

  Fly   379 TCNGLF----------------ISDIPLHDATREVIL--------------------------VG 401
            .|..|.                .||:.:.:..:||:.                          :.
 Worm   895 ECRALVEKTVRRVYSDPYFRPDTSDLEVQNYVKEVMAACWHHDPYQRPEFKTIKNKLKPLFHQIY 959

  Fly   402 EQARAQDGLRRRMDK----IKNSIEEANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSSIDAKTY 462
            :| ...|.:...|:|    :::.::|....:..|::::..||..:.|:.:||:|..|..:..:.:
 Worm   960 KQ-NIMDHMVLMMEKYQTQLEDLVDERTIELKDEQRRSQHLLQRMLPSSVAEQLLAGQDVIPEAF 1023

  Fly   463 PDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGL--HR 525
            |.|||.||||||||:|...:||..|::.|..||..||.....:||||||||||||.|.||:  ::
 Worm  1024 PPVTIYFSDIVGFTTISGESTPMEVVTFLNKLYTLFDSIIRRYDVYKVETIGDAYMVVSGVPQYK 1088

  Fly   526 ASIYDAHKVAWMALKMIDAC-SKHITHDG-EQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTI 588
            ...|.|.::|.||:.::.|. |..|.|.. |.:.:|||:|||..:|||||:.||||.|||.:|..
 Worm  1089 TMEYHAEQIAMMAIHILSAVRSFSIPHRSCEPLMIRIGMHTGPCVAGVVGKTMPRYTLFGDTVNT 1153

  Fly   589 ANKFESGSEALKINVSPTTKD----------------------------WLTKHEGFEFELQPRD 625
            |::.||..|||:|:.|.:|:.                            ||....|:||.....|
 Worm  1154 ASRMESNGEALRIHCSSSTQKVLTSIDQGFLLEERGSLAIKGKGQMTTYWLNGRAGYEFTETIED 1218

  Fly   626 PSFLPKEFPNP 636
            ...:|..||.|
 Worm  1219 KMVVPDIFPRP 1229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002 16/76 (21%)
HNOBA 259..451 CDD:285003 40/249 (16%)
CYCc 430..619 CDD:214485 85/220 (39%)
Guanylate_cyc 457..647 CDD:278633 84/212 (40%)
gcy-12NP_494995.2 PBP1_Speract_GC_like 123..545 CDD:107365
ANF_receptor 140..519 CDD:279440
PK_GC-A_B 648..957 CDD:270944 52/321 (16%)
TyrKc 688..951 CDD:197581 52/315 (17%)
HNOBA <967..1012 CDD:285003 9/44 (20%)
CYCc 991..1183 CDD:214485 82/191 (43%)
Guanylate_cyc 1018..1206 CDD:278633 76/187 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.