DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and gucy2f

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_571939.2 Gene:gucy2f / 140424 ZFINID:ZDB-GENE-011128-7 Length:1107 Species:Danio rerio


Alignment Length:270 Identity:93/270 - (34%)
Similarity:152/270 - (56%) Gaps:20/270 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 EVILVGEQARAQDGLRRRMDKIKNSIE----EANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSS 456
            ::|..|::....|.:.|.:::..:::|    |....:..|:::...||..:.|..:||.|..|:|
Zfish   811 KLINKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVEKQRTEKLLSEMLPPSVAEALKTGAS 875

  Fly   457 IDAKTYPDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVAS 521
            ::.:.:..|||.||||||||:|.|.:.|..|:.:|..||..||......||||||||||||.|||
Zfish   876 VEPEYFDQVTIYFSDIVGFTTISSLSDPIEVVDLLNDLYSLFDAVLGSHDVYKVETIGDAYMVAS 940

  Fly   522 GLHRAS-IYDAHKVAWMALKMIDAC-SKHITHDGE-QIKMRIGLHTGTVLAGVVGRKMPRYCLFG 583
            ||.:.: ...|.::|.|:|.::.:. |..:.|..| .:::|||:|:|..:|||||..||||||||
Zfish   941 GLPKKNGNKHAAEIANMSLNILSSVGSFKMRHMPEVPVRIRIGIHSGPCVAGVVGLTMPRYCLFG 1005

  Fly   584 HSVTIANKFESGSEALKINVSPTTKDWL-TKHEGFEFELQPRDPSFLPKEFPNPGGTETCY---- 643
            .:|..|::.||.....:|:|:.:|...| :.::|::.:::.:      .|....|..||.:    
Zfish  1006 DTVNTASRMESTGLPYRIHVNISTVQILRSLNDGYKIDVRGK------TELKGKGIEETYWLVGK 1064

  Fly   644 --FLESFRNP 651
              |.:...||
Zfish  1065 ANFTKPLPNP 1074

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 12/58 (21%)
CYCc 430..619 CDD:214485 80/192 (42%)
Guanylate_cyc 457..647 CDD:278633 76/199 (38%)
gucy2fNP_571939.2 PBP1_sensory_GC_DEF_like 59..440 CDD:107366
PK_GC-2D 551..816 CDD:270945 1/4 (25%)
HNOBA <825..870 CDD:311573 9/44 (20%)
CYCc 850..1042 CDD:214485 80/191 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.