DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and Gyc88E

DIOPT Version :10

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_321074.6 Gene:Gyc88E / 1281135 VectorBaseID:AGAMI1_008059 Length:1009 Species:Anopheles gambiae


Alignment Length:102 Identity:23/102 - (22%)
Similarity:41/102 - (40%) Gaps:23/102 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TVHHLDPSVQA---------KRLQIGGKDTGIFLYPYMAAIEFAQKLVGNGAIVAQRYILTSASA 67
            ::.:::||..|         ||..|....|        ::|:....|.....:..||.:.:..|.
Mosquito   574 SIRNVEPSAPATHAPLLGDIKRTSISRDST--------SSIDVDSVLPERTRLRRQRRVRSQDSV 630

  Fly    68 VAEPHDSLYKV-QLGANVFKGPGDLYEVLTIYKHPQY 103
            ..:|.|.:.:: :|.|.:   .|.|.||..:.|  ||
Mosquito   631 EEKPEDVIERLNKLKARI---SGALSEVKGVLK--QY 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB <109..208 CDD:462233
HNOBA 259..451 CDD:462234
Guanylate_cyc 457..647 CDD:425528
Gyc88EXP_321074.6 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.