DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and Gucy2f

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_446283.1 Gene:Gucy2f / 116556 RGDID:620439 Length:1108 Species:Rattus norvegicus


Alignment Length:263 Identity:98/263 - (37%)
Similarity:146/263 - (55%) Gaps:20/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 GEQARAQDGLRRRMDKIKNSIE----EANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSSIDAKT 461
            |::....|.:.|.:::..:::|    |....:..|::|...||..:.|..:||.|..|.:::.:.
  Rat   815 GKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEIEKQKTEKLLTQMLPPSVAESLKKGCTVEPEG 879

  Fly   462 YPDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGL-HR 525
            :..||:.||||||||:|.:.:.|..|:.:|..||..||......||||||||||||.||||| .|
  Rat   880 FDLVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKR 944

  Fly   526 ASIYDAHKVAWMALKMIDACS----KHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSV 586
            .....|.::|.|:|.::.:..    :|:..  ..:::|||||||.|:|||||..||||||||.:|
  Rat   945 NGSRHAAEIANMSLDILSSVGTFKMRHMPE--VPVRIRIGLHTGPVVAGVVGLTMPRYCLFGDTV 1007

  Fly   587 TIANKFESGSEALKINVSPTTKDWL-TKHEGFEFELQPRDPSFLPKEFPNPGGTETCYFL--ESF 648
            ..|::.||.....:|:||.:|...| |..||:|.||:.|      .|....|..||.:.:  :.|
  Rat  1008 NTASRMESTGLPYRIHVSLSTVTILRTLSEGYEVELRGR------TELKGKGTEETFWLVGKKGF 1066

  Fly   649 RNP 651
            ..|
  Rat  1067 TKP 1069

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 12/53 (23%)
CYCc 430..619 CDD:214485 83/194 (43%)
Guanylate_cyc 457..647 CDD:278633 82/197 (42%)
Gucy2fNP_446283.1 PBP1_sensory_GC_DEF_like 54..435 CDD:107366
ANF_receptor 75..412 CDD:279440
PKc_like 545..815 CDD:304357 98/263 (37%)
TyrKc 565..809 CDD:197581
HNOBA <824..869 CDD:285003 10/44 (23%)
CYCc 848..1040 CDD:214485 83/193 (43%)
Guanylate_cyc 875..1062 CDD:278633 82/194 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.