DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and Adcy9

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_011244107.1 Gene:Adcy9 / 11515 MGIID:108450 Length:1372 Species:Mus musculus


Alignment Length:407 Identity:100/407 - (24%)
Similarity:172/407 - (42%) Gaps:73/407 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 TMLMGRPTSVSKTIPETVQRSNSSNASDLQMNSSSFC--KMFPWHFIMNEQLEL-VQLGRGFSKL 292
            |.|.||..|.:.|:..|...:..|     |:.|.|.|  .:...:.:|...|.| :.||..:|.|
Mouse   196 TPLSGRVDSSNHTLTATPADTCLS-----QVGSFSICIEVLLLLYTVMQLPLYLSLFLGVVYSVL 255

  Fly   293 YKPYMADFGCQATTYFDFKRPKGLTMKFRDIVRRTYTPFLIGLNNPPGAVDFP------------ 345
            ::    .||........:..|                        .|||:.:.            
Mouse   256 FE----TFGYHFRNEDCYPSP------------------------GPGALHWELLSRALLHVCIH 292

  Fly   346 AIGLEIKGQMVHCPESNSLLFIGSPFLDGLDGLTCNGLFISDIPLHDATREVILVGEQAR--AQD 408
            |||:.: ..|......::.|.:|...:.|           .|:.:..|.:|.::.....|  |.|
Mouse   293 AIGIHL-FVMSQVRSRSTFLKVGQSIMHG-----------KDLEVEKALKERMIHSVMPRIIADD 345

  Fly   409 GLRRRMDKIKNSIEEANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSSIDAKTYPDVTILFSDIV 473
            .:::..::.:||::...::..|.|||..|    |..|.||.:.:....|:     :|:|||:|||
Mouse   346 LMKQGDEESENSVKRHATSSPKNRKKKSS----IQKAPIAFRPFKMQQIE-----EVSILFADIV 401

  Fly   474 GFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMA 538
            |||.:.:..:...::.:|..|:..||..|:.....|:.|:||.|...:|........|:....|.
Mouse   402 GFTKMSANKSAHALVGLLNDLFGRFDRLCEQTKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMG 466

  Fly   539 LKMIDACSKHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINV 603
            |.||.|..:......|.:.||:|:||||||.|::|.:..::.::.:.|.:||..|....|.|:::
Mouse   467 LGMIKAIEQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHI 531

  Fly   604 SPTTKDWLTKHEGFEFE 620
            |..|..:|  .:.:|.|
Mouse   532 SEATAKYL--DDRYEME 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 41/208 (20%)
CYCc 430..619 CDD:214485 58/188 (31%)
Guanylate_cyc 457..647 CDD:278633 51/164 (31%)
Adcy9XP_011244107.1 MFS <134..260 CDD:391944 19/72 (26%)
Guanylate_cyc 385..573 CDD:306677 51/169 (30%)
Guanylate_cyc 1069..1260 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.