DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and Adcy7

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_006530643.1 Gene:Adcy7 / 11513 MGIID:102891 Length:1146 Species:Mus musculus


Alignment Length:302 Identity:77/302 - (25%)
Similarity:141/302 - (46%) Gaps:59/302 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 IGLEIKGQMVHCPESNSLLFIGSPFLDGLDGLTCNGLFISDIPLHDATREVILVGEQARAQDGLR 411
            :||::.        :|:::.:|..|         .|.|... .|.||:|::.:...:...   :|
Mouse   178 LGLQLL--------ANAVILLGGNF---------TGAFHKH-QLQDASRDLFIYTVKCIQ---IR 221

  Fly   412 RRMDKIKNSIEEANSAVTKERKKNVSLLHLIFPAEIA--------EKLWLGS-----------SI 457
            |::            .|.|.:::|  ||..:.||.|:        |:|..|.           |:
Mouse   222 RKL------------RVEKRQQEN--LLLSVLPAHISMGMKLAIIERLKEGGDRHYMPDNNFHSL 272

  Fly   458 DAKTYPDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASG 522
            ..|.:.:|:||::||||||.:.|..:|..::.:|..|:..||:.....:..:::.:||.|...||
Mouse   273 YVKRHQNVSILYADIVGFTRLASDCSPKELVVVLNELFGKFDQIAKANECMRIKILGDCYYCVSG 337

  Fly   523 LHRASIYDAHKVAWMALKMIDACSKHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVT 587
            |..:....|.....|.|.:.:|..:.....|..|.||:|:|:|.||.||:|.:..:|.::.|.|:
Mouse   338 LPVSLPTHARNCVKMGLDICEAIKQVREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVS 402

  Fly   588 IANKFESGSEALKINVSPTTKDWLTKHEGFEFE---LQPRDP 626
            :||:.|:.....:::::..|.:.|.|  .:|.|   .:.|||
Mouse   403 LANRMEAAGVPGRVHITEATLNHLDK--AYEVEDGHGEQRDP 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 22/111 (20%)
CYCc 430..619 CDD:214485 58/207 (28%)
Guanylate_cyc 457..647 CDD:278633 52/173 (30%)
Adcy7XP_006530643.1 AC_N <75..251 CDD:318454 21/107 (20%)
Guanylate_cyc 272..422 CDD:306677 44/149 (30%)
DUF1053 487..593 CDD:399378
Guanylate_cyc 890..1085 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.