DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and Adcy6

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_006520366.3 Gene:Adcy6 / 11512 MGIID:87917 Length:1254 Species:Mus musculus


Alignment Length:236 Identity:64/236 - (27%)
Similarity:114/236 - (48%) Gaps:29/236 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   423 EANSAVTKERKKNVSLLHLIFPAEIAEKL----------WLGSSIDAKTYPDVTILFSDIVGFTS 477
            :|...:..|.::...||..:.|..:|.::          .:...|..:.:.:|:|||:||.||||
Mouse   412 QARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTS 476

  Fly   478 ICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMALKMI 542
            :.|:.|...::..|..|:..||:........:::.:||.|...|||..|....||....|.:.||
Mouse   477 LASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMI 541

  Fly   543 DACS--KHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVSP 605
            :|.|  :.:|  |..:.||:|:|:|.|..||:|.:..::.::.:.||:||..|:|..|.:|:::.
Mouse   542 EAISLVREVT--GVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITR 604

  Fly   606 TTKDWLTKHEGFEFELQPRDPSFLPKEFPNPGGTETCYFLE 646
            .|..:|..    ::|::           |..||....|..|
Mouse   605 ATLQYLNG----DYEVE-----------PGRGGERNAYLKE 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 6/27 (22%)
CYCc 430..619 CDD:214485 57/200 (29%)
Guanylate_cyc 457..647 CDD:278633 58/192 (30%)
Adcy6XP_006520366.3 AC_N 83..454 CDD:318454 6/41 (15%)
Guanylate_cyc 456..640 CDD:306677 58/192 (30%)
DUF1053 668..754 CDD:368844
Guanylate_cyc 1056..1250 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.