DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and ADCY9

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_005255136.1 Gene:ADCY9 / 115 HGNCID:240 Length:1372 Species:Homo sapiens


Alignment Length:464 Identity:112/464 - (24%)
Similarity:198/464 - (42%) Gaps:83/464 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 VCAGEGELIFTSERPV---IAWLLLGSLKALTRMLYKVDVNIKIE---PVEGDARRYRYLFSLVK 226
            ||.  |..:||..:..   .||..|    |||.:::.:.:..:.:   ||.|..           
Human   155 VCV--GFFLFTFTKLYARHYAWTSL----ALTLLVFALTLAAQFQVLTPVSGRG----------- 202

  Fly   227 DNSQTMLMGRPTSVSKTIPETVQRSNSSNASDLQMNSSSFC--KMFPWHFIMNEQLEL-VQLGRG 288
            |:|......|||....:                |:.|.|.|  .:|..:.:|:..|.| :.||..
Human   203 DSSNLTATARPTDTCLS----------------QVGSFSMCIEVLFLLYTVMHLPLYLSLCLGVA 251

  Fly   289 FSKLYKPYMADFGCQATTYFDFKRPKGLTMKFRDIVRRTYTPFLIGLNNPPGAVDFPAIGLEIKG 353
            :|.|::.:...|..:|.    |..|....:.:..:.|        ||.:  |.:....:.|.:..
Human   252 YSVLFETFGYHFRDEAC----FPSPGAGALHWELLSR--------GLLH--GCIHAIGVHLFVMS 302

  Fly   354 QMVHCPESNSLLFIGSPFLDGLDGLTCNGLFISDIPLHDATREVILVGEQAR--AQDGLRRRMDK 416
            |:   ...::.|.:|...:.|           .|:.:..|.:|.::.....|  |.|.:::..::
Human   303 QV---RSRSTFLKVGQSIMHG-----------KDLEVEKALKERMIHSVMPRIIADDLMKQGDEE 353

  Fly   417 IKNSIEEANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSSIDAKTYPDVTILFSDIVGFTSICSR 481
            .:||::...::..|.|||..|    |..|.||.:.:....|:     :|:|||:||||||.:.:.
Human   354 SENSVKRHATSSPKNRKKKSS----IQKAPIAFRPFKMQQIE-----EVSILFADIVGFTKMSAN 409

  Fly   482 ATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMALKMIDACS 546
            .:...::.:|..|:..||..|:.....|:.|:||.|...:|........|:....|.|.||.|..
Human   410 KSAHALVGLLNDLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIE 474

  Fly   547 KHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVSPTTKDWL 611
            :......|.:.||:|:||||||.|::|.:..::.::.:.|.:||..|....|.|:::|..|..:|
Human   475 QFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYL 539

  Fly   612 TKHEGFEFE 620
              .:.:|.|
Human   540 --DDRYEME 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002 11/42 (26%)
HNOBA 259..451 CDD:285003 42/196 (21%)
CYCc 430..619 CDD:214485 58/188 (31%)
Guanylate_cyc 457..647 CDD:278633 51/164 (31%)
ADCY9XP_005255136.1 DUF2339 <118..>301 CDD:287113 40/192 (21%)
CYCc 326..544 CDD:214485 65/228 (29%)
Guanylate_cyc 385..573 CDD:278633 51/169 (30%)
CYCc 1043..1243 CDD:214485
Guanylate_cyc 1069..1260 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.