DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and Gucy2e

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_570093.2 Gene:Gucy2e / 113911 RGDID:69322 Length:1123 Species:Rattus norvegicus


Alignment Length:284 Identity:103/284 - (36%)
Similarity:155/284 - (54%) Gaps:21/284 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 GEQARAQDGLRRRMDKIKNSIE----EANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSSIDAKT 461
            |::....|.:.|.::|...|:|    |....:..||:|...||..:.|..:|..|.:|::::.:.
  Rat   824 GKKTSVADSMLRMLEKYSQSLEGLVQERTEELELERRKTERLLSQMLPPSVAHALKMGTTVEPEY 888

  Fly   462 YPDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGL-HR 525
            :..|||.||||||||:|.:.:.|..|:..|..||..||...|..||||||||||||.||||| .|
  Rat   889 FDQVTIYFSDIVGFTTISALSEPIEVVGFLNDLYTMFDAVLDSHDVYKVETIGDAYMVASGLPRR 953

  Fly   526 ASIYDAHKVAWMALKMID-ACSKHITHDGE-QIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTI 588
            .....|.::|.|||:::. |.:..:.|..: .|::|.|||:|..:|||||..||||||||.:|..
  Rat   954 NGNRHAAEIANMALEILSYAGNFRMRHAPDVPIRVRAGLHSGPCVAGVVGLTMPRYCLFGDTVNT 1018

  Fly   589 ANKFESGSEALKINVS-PTTKDWLTKHEGFEFELQPRDPSFLPKEFPNPGGTETCY------FLE 646
            |::.||.....:|:|| .|.:..|:..||::.:::.:      .|....|..||.:      |..
  Rat  1019 ASRMESTGLPYRIHVSRNTVQALLSLDEGYKIDVRGQ------TELKGKGLEETYWLTGKTGFCR 1077

  Fly   647 SFRNP-ALDSELPLVEHINVSMKT 669
            |...| ::....|..:|||..::|
  Rat  1078 SLPTPLSIQPGDPWQDHINQEIRT 1101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 14/53 (26%)
CYCc 430..619 CDD:214485 84/192 (44%)
Guanylate_cyc 457..647 CDD:278633 80/199 (40%)
Gucy2eNP_570093.2 PBP1_sensory_GC_DEF-like 71..445 CDD:380594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 529..556
PK_GC-2D 554..824 CDD:270945 103/284 (36%)
CYCc 861..1050 CDD:214485 82/188 (44%)
Interaction with NCALD. /evidence=ECO:0000269|PubMed:18178149 880..921 16/40 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.