DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and ADCY7

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_011521137.1 Gene:ADCY7 / 113 HGNCID:238 Length:1086 Species:Homo sapiens


Alignment Length:218 Identity:62/218 - (28%)
Similarity:107/218 - (49%) Gaps:24/218 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   431 ERKKNVSLLHLIFPAEIAEKLWLG-------------------SSIDAKTYPDVTILFSDIVGFT 476
            |:::..:||..:.||.|:..:.|.                   .|:..|.:.:|:||::||||||
Human   225 EKRQQENLLLSVLPAHISMGMKLAIIERLKEHGDRRCMPDNNFHSLYVKRHQNVSILYADIVGFT 289

  Fly   477 SICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMALKM 541
            .:.|..:|..::.:|..|:..||:.....:..:::.:||.|...|||..:....|.....|.|.|
Human   290 QLASDCSPKELVVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDM 354

  Fly   542 IDACSKHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVSPT 606
            ..|..:.....|..|.||:|:|:|.||.||:|.:..:|.::.|.|::||:.|:.....:::::..
Human   355 CQAIKQVREATGVDINMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEA 419

  Fly   607 TKDWLTKHEGFEFE---LQPRDP 626
            |...|.|  .:|.|   .|.|||
Human   420 TLKHLDK--AYEVEDGHGQQRDP 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 6/19 (32%)
CYCc 430..619 CDD:214485 56/206 (27%)
Guanylate_cyc 457..647 CDD:278633 54/173 (31%)
ADCY7XP_011521137.1 AC_N <73..249 CDD:292831 7/23 (30%)
CYCc 224..429 CDD:214485 56/205 (27%)
Guanylate_cyc 270..432 CDD:278633 49/163 (30%)
DUF1053 485..592 CDD:283888
CYCc 848..1052 CDD:214485
Guanylate_cyc 871..1073 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.