DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and ADCY6

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001377760.1 Gene:ADCY6 / 112 HGNCID:237 Length:1168 Species:Homo sapiens


Alignment Length:236 Identity:64/236 - (27%)
Similarity:114/236 - (48%) Gaps:29/236 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   423 EANSAVTKERKKNVSLLHLIFPAEIAEKL----------WLGSSIDAKTYPDVTILFSDIVGFTS 477
            :|...:..|.::...||..:.|..:|.::          .:...|..:.:.:|:|||:||.||||
Human   326 QARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTS 390

  Fly   478 ICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMALKMI 542
            :.|:.|...::..|..|:..||:........:::.:||.|...|||..|....||....|.:.||
Human   391 LASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMI 455

  Fly   543 DACS--KHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVSP 605
            :|.|  :.:|  |..:.||:|:|:|.|..||:|.:..::.::.:.||:||..|:|..|.:|:::.
Human   456 EAISLVREVT--GVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITR 518

  Fly   606 TTKDWLTKHEGFEFELQPRDPSFLPKEFPNPGGTETCYFLE 646
            .|..:|..    ::|::           |..||....|..|
Human   519 ATLQYLNG----DYEVE-----------PGRGGERNAYLKE 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 6/27 (22%)
CYCc 430..619 CDD:214485 57/200 (29%)
Guanylate_cyc 457..647 CDD:278633 58/192 (30%)
ADCY6NP_001377760.1 AC_N <16..368 CDD:318454 6/41 (15%)
Guanylate_cyc 370..554 CDD:306677 58/192 (30%)
DUF1053 582..668 CDD:399378
Guanylate_cyc 970..1164 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.