DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and ADCY5

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001365188.1 Gene:ADCY5 / 111 HGNCID:236 Length:1286 Species:Homo sapiens


Alignment Length:276 Identity:72/276 - (26%)
Similarity:134/276 - (48%) Gaps:35/276 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 ISDIPLHDATREVILVGEQARAQDGLRRRMDKIKNSIEEANSAVTKERKKNVSLLHLIFPAEIAE 449
            :|::.:...| .::.|.....|:...|:...:.:..| :|.....:|.::...||..:.|..:| 
Human   380 VSNVLIFSCT-NIVGVCTHYPAEVSQRQAFQETRECI-QARLHSQRENQQQERLLLSVLPRHVA- 441

  Fly   450 KLWLGSSIDAK------------TYPDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFC 502
             :.:.:.|:||            .:.:|:|||:||.||||:.|:.|...::..|..|:..||:..
Human   442 -MEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLA 505

  Fly   503 DFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMALKMIDACS--KHITHDGEQIKMRIGLHTG 565
            ......:::.:||.|...|||..|....||....|.:.||:|.|  :.:|  |..:.||:|:|:|
Human   506 AENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREVT--GVNVNMRVGIHSG 568

  Fly   566 TVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVSPTTKDWLTKHEGFEFELQPRDPSFLP 630
            .|..||:|.:..::.::.:.||:||..|:|.:|.:|:::..|.::|..    ::|::        
Human   569 RVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLNYLNG----DYEVE-------- 621

  Fly   631 KEFPNPGGTETCYFLE 646
               |..||....|..|
Human   622 ---PGCGGERNAYLKE 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 12/65 (18%)
CYCc 430..619 CDD:214485 59/202 (29%)
Guanylate_cyc 457..647 CDD:278633 60/204 (29%)
ADCY5NP_001365188.1 AC_N 1..458 CDD:318454 15/81 (19%)
Guanylate_cyc 460..633 CDD:306677 56/189 (30%)
DUF1053 668..760 CDD:399378
Guanylate_cyc 1087..1281 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.