DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and LOC110440024

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_021334171.1 Gene:LOC110440024 / 110440024 -ID:- Length:416 Species:Danio rerio


Alignment Length:457 Identity:85/457 - (18%)
Similarity:151/457 - (33%) Gaps:156/457 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 IQLLTAPSNEDLNTAVTSLVAKYRQNWPNIHKLKLDPQTFKSCANYDYLADIQEL--LLKMDEAS 109
            :.||:|.: .|.|    |.:|:::....::.||       .||:....||.|.||  |.|:..::
Zfish    81 LALLSAVA-MDFN----SSLAQWQATEASLEKL-------TSCSTNVTLALIAELQTLRKLSSST 133

  Fly   110 -------ASEILVLLGEELITCCCTGIIERAFRCLGTDLQEFLGSLDGVYDVLKLQE-------- 159
                   .:.:::|...:   ||.:..::...:....:||||...|..     .|.|        
Zfish   134 VDKNKQETNSLIMLTANQ---CCTSTDLDSLGQPCDIELQEFCDHLQS-----NLSEMLNATWRG 190

  Fly   160 --EDVTDTGFVCAGEGELIFT-----------SERPVIAWLLLGSLKAL-----TRMLYKVDVNI 206
              .|..||........|::.|           ...|  .|..:.:||.|     ...|.||:...
Zfish   191 NFADANDTTVFTLAIEEILNTWGVKDIDVSLLQHNP--TWTDVLALKLLLTAQELNYLKKVENQD 253

  Fly   207 KIEPVEGDARRYRYLFSLVKDNSQTMLMGRPTSVSKTIPETVQRSNSSNASDLQMNSSSFCKMFP 271
            :|..|..       |.:::||.|:.:......::...:       |.:|..||...:|:..:...
Zfish   254 EIWQVTA-------LLTVLKDMSENLHQCWMENIDVDL-------NLTNVKDLLYTTSTSSEGST 304

  Fly   272 WHFIMNEQLELVQLGRGFSKLYKPYMADFGCQATTYFDFKRPKGLTMKFRDIVRRTYTPFLIGLN 336
            ...:||.| ..|....|:|                         |.:|.|||             
Zfish   305 DLALMNVQ-RCVHFRAGWS-------------------------LKLKSRDI------------- 330

  Fly   337 NPPGAVDFPAIGLEIKGQMVHCPESNSLLFIGSPFLDGLDGLTCNGLFISDIPLHDATREVILVG 401
                   ..:|.|::....:.|     |::                      |:      |:|..
Zfish   331 -------SSSISLKVCLLTIAC-----LIY----------------------PI------VLLSF 355

  Fly   402 EQARAQDGLRRRMDKIKNSIEEANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSSIDAKTYPDVT 466
            :|      :...:.....|:.|....:.:||:....|||.:.|..:|::|......:|::|..|.
Zfish   356 KQ------MTEWIQDYAQSLREKTEDLKRERRLAEDLLHQMLPKSVAKQLRQNKHFEAESYEKVL 414

  Fly   467 IL 468
            .|
Zfish   415 YL 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002 34/166 (20%)
HNOBA 259..451 CDD:285003 30/191 (16%)
CYCc 430..619 CDD:214485 12/39 (31%)
Guanylate_cyc 457..647 CDD:278633 4/12 (33%)
LOC110440024XP_021334171.1 HNOBA <369..399 CDD:311573 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D531253at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.