DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and ADCY1

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_066939.1 Gene:ADCY1 / 107 HGNCID:232 Length:1119 Species:Homo sapiens


Alignment Length:306 Identity:87/306 - (28%)
Similarity:142/306 - (46%) Gaps:57/306 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 SNSLLFIGSPFLDGLDGLTCNGLFISDIPLHDATREVILVGEQARA--QDGLRRRMDKIKNSIEE 423
            :|:|||:         |:...|:|:. |....:.|:..|   |||:  :|.||         :|:
Human   216 ANALLFV---------GVNMYGVFVR-ILTERSQRKAFL---QARSCIEDRLR---------LED 258

  Fly   424 ANSAVTKERKKNVSLL-----------HLIFPAEIAEKLWLGSSIDAKTYPDVTILFSDIVGFTS 477
            .|.   |:.:..:|||           .|..|..|..|:::      :.:.:|:|||:||||||.
Human   259 ENE---KQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYI------QRHDNVSILFADIVGFTG 314

  Fly   478 ICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMALKMI 542
            :.|:.|...::.:|..|:..|||........:::.:||.|...|||.:.....||....|.|.||
Human   315 LASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMI 379

  Fly   543 DACSKHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVSPTT 607
            |..:.........:.||:|||||.||.||:|.:..:|.::.:.||:||..|:.....|::::.||
Human   380 DTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTT 444

  Fly   608 KDWLTKHEGFEFELQP----RDPSFLPKEFPNPGGTETCYFLESFR 649
            ...|..    ::|::|    ...|||...     ..||.:.:.|.|
Human   445 LACLNG----DYEVEPGYGHERNSFLKTH-----NIETFFIVPSHR 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 25/102 (25%)
CYCc 430..619 CDD:214485 60/199 (30%)
Guanylate_cyc 457..647 CDD:278633 59/193 (31%)
ADCY1NP_066939.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
AC_N <161..292 CDD:292831 25/100 (25%)
CYCc 258..453 CDD:214485 61/207 (29%)
Guanylate_cyc 294..476 CDD:278633 59/196 (30%)
Interaction with calmodulin. /evidence=ECO:0000250 493..520
CYCc 826..1037 CDD:214485
Guanylate_cyc 859..1056 CDD:278633
Interaction with calmodulin. /evidence=ECO:0000250 1024..1047
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.