DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and LOC100496629

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_031761324.1 Gene:LOC100496629 / 100496629 -ID:- Length:744 Species:Xenopus tropicalis


Alignment Length:333 Identity:109/333 - (32%)
Similarity:169/333 - (50%) Gaps:61/333 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 GLDGLTCNGLFISDI-------------PLHDATREV--------------------ILVGEQAR 405
            |...:.||....:|:             .|.|.::|:                    :||     
 Frog   316 GQTSMLCNPALTTDLNYVQECLHKNANKKLRDKSKEILSTISLKISLFTVACFMYPLVLV----- 375

  Fly   406 AQDGLRRRMDKIKN---SIEEANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSSIDAKTYPDVTI 467
               ..::..:.|:|   :::|....:.|||:....|||.:.|..:|::|.....::|::|..|||
 Frog   376 ---SFKQMTEWIQNYAINLKERTEDLKKERRLAEDLLHQMLPKSVAKQLRKHKHVEAESYEQVTI 437

  Fly   468 LFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAH 532
            .||||||||.|.:..||..|:.||..||..||...:.::|||||||||||.|.|||...: |:.|
 Frog   438 FFSDIVGFTLISASCTPLQVVEMLNSLYVCFDSRIESYNVYKVETIGDAYMVVSGLPERN-YNKH 501

  Fly   533 --KVAWMALKMIDACSK----HITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANK 591
              ::|.|:|.::.|..:    |:.:  |::::|.|:|||..:|||||.|||||||||.:|..|::
 Frog   502 ADEIAKMSLDLVAAVRQVIIPHLPN--ERLQLRAGIHTGPCVAGVVGYKMPRYCLFGDTVNTASR 564

  Fly   592 FESGSEALKINVSPTTKDWLTKHEGFEFELQPRDPSFLPKEFPNPGGTETCYFLESFRNPALDSE 656
            .||.|...||::|..|...|...:.:|.||:..      .|....|..:| |:|...:|.::.::
 Frog   565 MESTSLPQKIHISSATYQVLLVDDAYEIELRGE------IEVKGKGKMKT-YWLLGNKNYSVQND 622

  Fly   657 LPLVEHIN 664
             .||.|.|
 Frog   623 -SLVCHWN 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 20/112 (18%)
CYCc 430..619 CDD:214485 84/194 (43%)
Guanylate_cyc 457..647 CDD:278633 83/195 (43%)
LOC100496629XP_031761324.1 HNOBA <391..421 CDD:400168 9/29 (31%)
Guanylate_cyc 427..613 CDD:306677 83/195 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D531253at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.