DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and gucy2d

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_002942678.2 Gene:gucy2d / 100496590 XenbaseID:XB-GENE-1014102 Length:1081 Species:Xenopus tropicalis


Alignment Length:264 Identity:94/264 - (35%)
Similarity:146/264 - (55%) Gaps:22/264 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 GEQARAQDGLRRRMDKIKNSIE----EANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSSIDAKT 461
            |.:....|.:.|.:::..:::|    |....:..|::|...||..:.|..:||.|..|:.::.:.
 Frog   786 GRKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVEKQKTDKLLTQMLPPSVAEALKTGTPVEPEY 850

  Fly   462 YPDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRA 526
            :.:|||.||||||||:|.|.:.|..|:.:|..||..||......||||||||||||.|||||.:.
 Frog   851 FDEVTIYFSDIVGFTTISSLSDPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKT 915

  Fly   527 S-IYDAHKVAWMALKMIDACS----KHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSV 586
            : ...|.::|.|:|.::.:..    :|:  ....:::|||||:|..:|||||..||||||||.:|
 Frog   916 NGNRHAAEIANMSLDILSSVGSFKMRHM--PDVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTV 978

  Fly   587 TIANKFESGSEALKINVSPTTKDWL-TKHEGFEFELQPRDPSFLPKEFPNPGGTETCYFL---ES 647
            ..|::.||.....:::|:.:|...| :..||:.||::.:      .|.... |.|..|:|   |.
 Frog   979 NTASRMESTGLPYRVHVNLSTVTILHSLKEGYRFEVRGK------TELKGK-GVEDTYWLVGKEG 1036

  Fly   648 FRNP 651
            |..|
 Frog  1037 FTKP 1040

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 12/53 (23%)
CYCc 430..619 CDD:214485 79/194 (41%)
Guanylate_cyc 457..647 CDD:278633 77/198 (39%)
gucy2dXP_002942678.2 PBP1_sensory_GC_DEF-like 43..411 CDD:380594
PK_GC-2D 519..786 CDD:270945 94/264 (36%)
HNOBA <795..840 CDD:400168 10/44 (23%)
CYCc 820..1012 CDD:214485 79/193 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.