DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and adcy1

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_002933461.1 Gene:adcy1 / 100492373 XenbaseID:XB-GENE-950909 Length:1122 Species:Xenopus tropicalis


Alignment Length:303 Identity:82/303 - (27%)
Similarity:142/303 - (46%) Gaps:53/303 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 NSLLFIGSPFLDGLDGLTCNGLFISDIPLHDATREVILVGEQARAQDGLRRRMDKIKNSIEEANS 426
            |::||:         .:..:|:|:.            ::.|:|:     |:...:.:|.||: ..
 Frog   207 NAILFV---------SVNLSGVFVR------------ILTERAQ-----RKAFLQARNCIED-RL 244

  Fly   427 AVTKERKKNVSLLHLIFPAEIA-----------EKLWLGSSIDAKTYPDVTILFSDIVGFTSICS 480
            .:..|.:|...||..:.|..:|           |:::  ..|..:.:.:|:|||:|||||||:.|
 Frog   245 RLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIF--HKIYIQRHDNVSILFADIVGFTSLAS 307

  Fly   481 RATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMALKMIDAC 545
            :.|...::.:|..|:..|||........:::.:||.|...|||.:.....||....|.|.|||..
 Frog   308 QCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTI 372

  Fly   546 SKHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVSPTTKDW 610
            :.........:.||:|||||.||.||:|.:..:|.::.:.||:||..|:|....|::::..|.:.
 Frog   373 TSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAGGLPGKVHITKNTLEC 437

  Fly   611 LTKHEGFEFELQP----RDPSFLPKEFPNPGGTETCYFLESFR 649
            |..    ::|::|    ...|||.|.     ..||.:.:.|.|
 Frog   438 LNG----DYEVEPGYGHERNSFLKKH-----NIETFFIVPSHR 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 18/99 (18%)
CYCc 430..619 CDD:214485 61/199 (31%)
Guanylate_cyc 457..647 CDD:278633 62/193 (32%)
adcy1XP_002933461.1 AC_N <37..282 CDD:292831 18/103 (17%)
CYCc 248..443 CDD:214485 61/200 (31%)
Guanylate_cyc 284..466 CDD:278633 62/190 (33%)
CYCc 817..1028 CDD:214485
Guanylate_cyc 850..1047 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.