DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycalpha99B and gucy2g

DIOPT Version :9

Sequence 1:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_009305067.2 Gene:gucy2g / 100333350 ZFINID:ZDB-GENE-130531-70 Length:1127 Species:Danio rerio


Alignment Length:301 Identity:107/301 - (35%)
Similarity:159/301 - (52%) Gaps:44/301 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 LHDATREVILVGEQARAQDGLRRRMDKIKNS----IEEANSAVTKERKKNVSLLHLIFPAEIAEK 450
            |.||..|     ..|...|.:..:::|..|.    :||..|.:|.|:.:...||..:.|..||::
Zfish   810 LRDACPE-----SHANILDNMVNKLEKYANHLEEVVEERTSQLTVEKSRADKLLSSMLPRYIADQ 869

  Fly   451 LWLGSSIDAKTYPDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGD 515
            |..|.|::.::|..|||.||||||||::||.::...|:::|..||..||:....:||||||||||
Zfish   870 LMAGKSVEPRSYEMVTIFFSDIVGFTTMCSVSSALEVVTLLNDLYSLFDDIIKLYDVYKVETIGD 934

  Fly   516 AYCVASGLHRAS-IYDAHKVAWMALKMIDACSK-HITH-DGEQIKMRIGLHTGTVLAGVVGRKMP 577
            ||.|||||..:: ...|.:::.|||..:.:..: .|.| ..|::.:|||:::|.|:|||||..||
Zfish   935 AYMVASGLPISNGTLHAEEISTMALHFLSSIKRFKIRHLPNERLALRIGINSGPVVAGVVGSTMP 999

  Fly   578 RYCLFGHSVTIANKFESGSEALKINVSPTTKD---------------------------WLTKHE 615
            ||||||.:|..|::.||.|..|||::|.:|.|                           ||....
Zfish  1000 RYCLFGDTVNTASRMESNSLPLKIHISQSTADILLTIGTFELEERGDIEIKGKGTQKTFWLLSKP 1064

  Fly   616 GFEFELQPRDPSFLPKEFPNPGGTETCYFLESFRNPALDSE 656
            ||.|....:|.:..||     .||::|:..:.....|.|.:
Zfish  1065 GFTFPPTGQDSNPSPK-----SGTDSCHIKQEKTKAANDGD 1100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 18/64 (28%)
CYCc 430..619 CDD:214485 86/218 (39%)
Guanylate_cyc 457..647 CDD:278633 84/219 (38%)
gucy2gXP_009305067.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.