DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7582 and Tmem86b

DIOPT Version :9

Sequence 1:NP_651710.1 Gene:CG7582 / 43492 FlyBaseID:FBgn0039681 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001103074.1 Gene:Tmem86b / 690610 RGDID:1593455 Length:226 Species:Rattus norvegicus


Alignment Length:230 Identity:82/230 - (35%)
Similarity:112/230 - (48%) Gaps:45/230 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVPFLVTIVLYFSLVRKDPQGELWTTVLKCLPIFALVFYV--VAKGISLKKEYRRSLWILLG-LV 76
            |.||:|...|||.|...:.|....:.::||.||..||.::  ||.|.|.       .|:|.| |.
  Rat    25 LAPFIVACSLYFLLWIPEDQPSWVSALVKCQPILCLVLFLWAVAPGGSY-------TWLLQGALT 82

  Fly    77 FSSGGDALLNINLFP----FGMISFGVAHVFYISAFGWKPIKWFIGLLLYVAVSLCKFTGHYIRI 137
            .|:.|||.|   ::|    :||..|.|||:.|:.|||..|::  .||||  ..:|...|      
  Rat    83 CSAVGDACL---IWPEAFFYGMAVFSVAHLLYLWAFGLSPLQ--PGLLL--CTTLASLT------ 134

  Fly   138 PYLEYLKPPVVYFVHTKLDEILIIGVPIYCFLITTMLWRSLARAVDSRNFLAVFCAIGAILFVIS 202
             |..:|      .:|  |:..:::.|..|..::.|||||.|.        |......||:||:.|
  Rat   135 -YYSFL------LLH--LEPNMVLPVAAYGLILNTMLWRGLV--------LGRSAGWGAVLFIFS 182

  Fly   203 DALIAVTMFVGVPLPCARLQIMITYYAAQFAIALS 237
            |.::|...|| ..||.|||..|.||||||..:.||
  Rat   183 DGVLAWDTFV-YTLPFARLVTMSTYYAAQLLLTLS 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7582NP_651710.1 YhhN 38..237 CDD:285222 71/205 (35%)
Tmem86bNP_001103074.1 YhhN 48..217 CDD:400344 73/207 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341047
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4804
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I4679
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1516092at2759
OrthoFinder 1 1.000 - - FOG0003055
OrthoInspector 1 1.000 - - otm45869
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31885
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.860

Return to query results.
Submit another query.