DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7582 and Tmem86b

DIOPT Version :9

Sequence 1:NP_651710.1 Gene:CG7582 / 43492 FlyBaseID:FBgn0039681 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_011248988.1 Gene:Tmem86b / 68255 MGIID:1915505 Length:253 Species:Mus musculus


Alignment Length:230 Identity:82/230 - (35%)
Similarity:116/230 - (50%) Gaps:45/230 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVPFLVTIVLYFSLVRKDPQGELWTTVLKCLPIFALVFYV--VAKGISLKKEYRRSLWILLG-LV 76
            |.||::...|||.|.....|....:.::||.||..||.::  ||.|.|       |.|:|.| ||
Mouse    52 LAPFILACSLYFLLWIPVDQPSWVSALIKCQPILCLVVFLWAVAPGGS-------STWLLQGALV 109

  Fly    77 FSSGGDALLNINLFP----FGMISFGVAHVFYISAFGWKPIKWFIGLLLYVAVSLCKFTGHYIRI 137
            .|:.|||.|   ::|    :|..:|.|||:||:.|||..|::  .||||  ..:|...|      
Mouse   110 CSAVGDACL---IWPEAFFYGTAAFSVAHLFYLGAFGLTPLQ--PGLLL--CTTLASLT------ 161

  Fly   138 PYLEYLKPPVVYFVHTKLDEILIIGVPIYCFLITTMLWRSLARAVDSRNFLAVFCAIGAILFVIS 202
             |..:|      .:|  |::.:::.|..|..::.:||||||.....:        :.||:||..|
Mouse   162 -YYSFL------LLH--LEQGMVLPVMAYGLILNSMLWRSLVWGGSA--------SWGAVLFTFS 209

  Fly   203 DALIAVTMFVGVPLPCARLQIMITYYAAQFAIALS 237
            |.::|...|| ..||.|||..|.||||||..:.||
Mouse   210 DGVLAWDTFV-YSLPFARLVTMSTYYAAQLLLILS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7582NP_651710.1 YhhN 38..237 CDD:285222 72/205 (35%)
Tmem86bXP_011248988.1 YhhN 75..244 CDD:377946 74/207 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837328
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4804
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003055
OrthoInspector 1 1.000 - - otm43785
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31885
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5328
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.