DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7582 and M176.11

DIOPT Version :9

Sequence 1:NP_651710.1 Gene:CG7582 / 43492 FlyBaseID:FBgn0039681 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_872067.1 Gene:M176.11 / 353402 WormBaseID:WBGene00010947 Length:220 Species:Caenorhabditis elegans


Alignment Length:192 Identity:37/192 - (19%)
Similarity:69/192 - (35%) Gaps:53/192 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VLKCLPIFALVFYVVAKGISLKKEYRRSLWILLGLV---FSSGGDALLNIN-LFPFGMISFGVAH 101
            :|...|:..|....:|..::.|..:..::..|:..:   |.|       :| ..|...|.:.:|:
 Worm    31 ILLSAPLVILSILTLATTMNPKARFATAMSFLMSAIATYFQS-------VNRTGPASAIFYTIAN 88

  Fly   102 VFYISAFGWKPIKWFIGLLLYVAVSLCKFTGHYIRIPYLEYLKPPVVYFVHTKLDEILIIGVPIY 166
            |||.  |.::.|...:...: |.::.|...|.                |:|...|  |::.:|..
 Worm    89 VFYY--FSYRDIVTSVSSPI-VFLAACVSFGQ----------------FLHLLQD--LLVAIPFL 132

  Fly   167 CFLITTMLWRSLARAVDSRNFLAVFC-----------------AIGAILFVISDALIAVTMF 211
            ..::|.:|...:.....|    |..|                 .|||:|..:|..|:.:..|
 Worm   133 ATILTILLASHVVILATS----ASLCQNGQHGDYDARQASTVRLIGAVLAWLSAFLLLINSF 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7582NP_651710.1 YhhN 38..237 CDD:285222 37/192 (19%)
M176.11NP_872067.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4804
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D607628at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.