DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7582 and tmem86a

DIOPT Version :9

Sequence 1:NP_651710.1 Gene:CG7582 / 43492 FlyBaseID:FBgn0039681 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001120083.1 Gene:tmem86a / 100145092 XenbaseID:XB-GENE-1007200 Length:245 Species:Xenopus tropicalis


Alignment Length:242 Identity:88/242 - (36%)
Similarity:133/242 - (54%) Gaps:28/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AKSQGPKLVPFLVTIVLYFSLVRKDPQGELWTTVLKCLPIFALVFYVVAKGISLKKEYRRSLWIL 72
            |:|..|||:|||::...||:|.....:..|:..::|.||:..|.|::|...:|..:....|..|.
 Frog    18 ARSVIPKLLPFLISCYNYFALWLPLSEPNLFHALIKSLPVLCLGFFIVVHSLSQGRFSSYSKKIF 82

  Fly    73 LGLVFSSGGD-ALLNINLFPFGMISFGVAHVFYISAFGWKPIKWFIGLLLYVAVSLCKFTGHYIR 136
            :||:||:.|| .||..:.|..||:.||:||:.||.:||::|::    |.|::.::|......:..
 Frog    83 VGLMFSAAGDICLLWEDFFLHGMVMFGLAHIMYIISFGFRPLR----LRLFILLALFCAAFFFFA 143

  Fly   137 IPYLEYLKPPVVYFVHTKLDEILIIGVPIYCFLITTMLWRSLAR-AVDSRNF--LAVFCAIGAIL 198
            :|||.   .|.:|.            ||.|..||.||.||:||| ::.|..|  ..||.|:|:::
 Frog   144 LPYLH---GPFLYM------------VPGYSVLIGTMAWRALARVSLASYKFSWAHVFAALGSLI 193

  Fly   199 FVISDALIAVTMFVGVPLPCARLQIMITYYAAQFAIALSTA----DD 241
            ||:||..:||..|. .|:..:|..:|.|||..|..||||.|    ||
 Frog   194 FVVSDCFLAVDKFC-FPIENSRAIVMATYYGGQMFIALSIAGGSEDD 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7582NP_651710.1 YhhN 38..237 CDD:285222 71/202 (35%)
tmem86aNP_001120083.1 YhhN 48..232 CDD:377946 72/203 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6346
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I4529
OMA 1 1.010 - - QHG48600
OrthoDB 1 1.010 - - D1516092at2759
OrthoFinder 1 1.000 - - FOG0003055
OrthoInspector 1 1.000 - - otm48958
Panther 1 1.100 - - LDO PTHR31885
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5328
SonicParanoid 1 1.000 - - X3969
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.