DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bub3 and GLE2

DIOPT Version :9

Sequence 1:NP_001287587.1 Gene:Bub3 / 43490 FlyBaseID:FBgn0025457 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_011033.3 Gene:GLE2 / 856844 SGDID:S000000909 Length:365 Species:Saccharomyces cerevisiae


Alignment Length:339 Identity:117/339 - (34%)
Similarity:174/339 - (51%) Gaps:27/339 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LNNPPEDLISAVKFGPKSNQYMAASSWDGTLRFYDVP--ANQLRQKFVQDAPLLDCAFM-DIVHV 69
            :|:|.||.||.:.|.|:.:...:||||||.:|.:||.  ..|.|.:....:|:|...:. |...|
Yeast    31 INSPAEDSISDIAFSPQQDFMFSASSWDGKVRIWDVQNGVPQGRAQHESSSPVLCTRWSNDGTKV 95

  Fly    70 VSGSLDNQLRLFDVNTQAESIIGAHEEPIRCVEHAE----YVNGILTGSWDNTVKLWDMREKRCV 130
            .||..||.|:|:|:.:.....||.|..||:.:...:    ....|:|||||.|:|.||||:.:.|
Yeast    96 ASGGCDNALKLYDIASGQTQQIGMHSAPIKVLRFVQCGPSNTECIVTGSWDKTIKYWDMRQPQPV 160

  Fly   131 GTFEQNNGKVYSMSVIDEKIVVATSDRKVLIWDLRKMDSYIMKRESSLKYQTRCIRLFPNKEGYV 195
            .|..... :||||......:||||::|.:.|.:|....:......|.||:||||:..:...:||.
Yeast   161 STVMMPE-RVYSMDNKQSLLVVATAERHIAIINLANPTTIFKATTSPLKWQTRCVACYNEADGYA 224

  Fly   196 MSSIEGRVAVEYLDHDPEVQRRKFAFKCHRNREQN-------IEQIYPVNALSFHNVYQTFATGG 253
            :.|:|||.::.|:| |...::..|:|||||....|       ...:||||:::||.:|.||.|.|
Yeast   225 IGSVEGRCSIRYID-DGMQKKSGFSFKCHRQTNPNRAPGSNGQSLVYPVNSIAFHPLYGTFVTAG 288

  Fly   254 SDGIVNIWDGFNKKRLCQFHEYDTSISTLNFSSDGSALAIGCSY------LDQLPETPATVPHPA 312
            .||..|.||...:.||..:.....||...:|:.:||..|...||      :...|:.|     ..
Yeast   289 GDGTFNFWDKNQRHRLKGYPTLQASIPVCSFNRNGSVFAYALSYDWHQGHMGNRPDYP-----NV 348

  Fly   313 IYIRYPTDQETKQK 326
            |.:...||:|.|:|
Yeast   349 IRLHATTDEEVKEK 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bub3NP_001287587.1 WD40 <10..296 CDD:225201 106/299 (35%)
WD40 16..262 CDD:295369 93/259 (36%)
WD40 repeat 16..53 CDD:293791 15/38 (39%)
WD40 repeat 59..93 CDD:293791 11/34 (32%)
WD40 repeat 98..134 CDD:293791 15/39 (38%)
WD40 repeat 141..175 CDD:293791 10/33 (30%)
WD40 repeat 182..222 CDD:293791 13/39 (33%)
WD40 repeat 237..283 CDD:293791 18/45 (40%)
GLE2NP_011033.3 WD40 36..333 CDD:421866 106/298 (36%)
WD40 repeat 39..78 CDD:293791 15/38 (39%)
WD40 repeat 84..119 CDD:293791 11/34 (32%)
WD40 repeat 124..163 CDD:293791 14/38 (37%)
WD40 repeat 170..204 CDD:293791 10/33 (30%)
WD40 repeat 211..250 CDD:293791 13/39 (33%)
WD40 repeat 272..298 CDD:293791 13/25 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53489
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.