DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bub3 and CG12782

DIOPT Version :9

Sequence 1:NP_001287587.1 Gene:Bub3 / 43490 FlyBaseID:FBgn0025457 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_611772.2 Gene:CG12782 / 37685 FlyBaseID:FBgn0034838 Length:336 Species:Drosophila melanogaster


Alignment Length:306 Identity:85/306 - (27%)
Similarity:142/306 - (46%) Gaps:24/306 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EFKLNNPPEDLISAVKFGPKSNQYMA--ASSWDGTLRFYDVPANQLRQKFVQDAPLLDCAFMDIV 67
            :::|.|||.|.|||::|.|:|:.:.|  |.|||.|:|.::|.|::|..|.:..   |:....|:.
  Fly    14 DYELPNPPNDTISALEFSPRSSSWNAICAGSWDNTVRIWEVQADRLVPKVMNS---LEGTPFDVT 75

  Fly    68 HVVSGS------LDNQLRLFDVNTQAESIIGAHEEPIR-CVEHAEYVNGILTGSWDNTVKLWDMR 125
            ...||:      ...|:..:|:.:.....:|.|....| |.....|   :.|.|||.:::.||.|
  Fly    76 WNDSGNKVYLSDSSGQVTEWDLESNQLRKVGLHARAARTCHWVGPY---LATTSWDKSIRFWDPR 137

  Fly   126 EKRCVGTFEQNNGKVYSMSVIDEKIVVATSDRKVLIWDLR--KMDSYIMKRESSLKYQTRCIRLF 188
            ....:...|..: :.|:..|:::..|||..||.:|.:.||  .::...||.......|.|.:.|.
  Fly   138 AAIELTRMELPD-RSYAADVLNDVAVVACGDRSILAYTLRGGPVEQGRMKSPGESNTQVRSVALH 201

  Fly   189 PNKE--GYVMSSIEGRVAVEYLDHDPEVQRRKFAFKCHRNREQNIEQIYPVNALSFHNVYQTFAT 251
            .|::  .::::...|.|..:.:.|    :...|..:|||.....|..:|.||.:..:.|.|..||
  Fly   202 QNRDLTSWLIAKTNGMVFDQSMAH----RTVSFPIRCHRRENSGILDVYAVNEVKVNMVTQHIAT 262

  Fly   252 GGSDGIVNIWDGFNKKRLCQFHEYDTSISTLNFSSDGSALAIGCSY 297
            .||||:...||...:.:|.:...:...|:....|.||...|....|
  Fly   263 VGSDGVFCFWDSQMRSKLLESKVHPQPITKCAISGDGKLFAYALGY 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bub3NP_001287587.1 WD40 <10..296 CDD:225201 83/298 (28%)
WD40 16..262 CDD:295369 71/258 (28%)
WD40 repeat 16..53 CDD:293791 17/38 (45%)
WD40 repeat 59..93 CDD:293791 6/39 (15%)
WD40 repeat 98..134 CDD:293791 10/36 (28%)
WD40 repeat 141..175 CDD:293791 12/35 (34%)
WD40 repeat 182..222 CDD:293791 7/41 (17%)
WD40 repeat 237..283 CDD:293791 14/45 (31%)
CG12782NP_611772.2 WD40 <19..303 CDD:225201 82/294 (28%)
WD40 25..303 CDD:295369 78/288 (27%)
WD40 repeat 26..64 CDD:293791 16/37 (43%)
WD40 repeat 71..101 CDD:293791 5/29 (17%)
WD40 repeat 109..146 CDD:293791 10/39 (26%)
WD40 repeat 195..235 CDD:293791 7/43 (16%)
WD40 repeat 242..272 CDD:293791 12/29 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447786
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1048963at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10971
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.