DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bub3 and Rae1

DIOPT Version :9

Sequence 1:NP_001287587.1 Gene:Bub3 / 43490 FlyBaseID:FBgn0025457 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_611597.1 Gene:Rae1 / 37467 FlyBaseID:FBgn0034646 Length:346 Species:Drosophila melanogaster


Alignment Length:312 Identity:102/312 - (32%)
Similarity:161/312 - (51%) Gaps:22/312 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RPPEFKLNNPPEDLISAVKFGPKSNQ--YMAASSWDGTLRFYDVPANQL---RQKFVQDAPLLD- 60
            |..:|::.:||:|.:||::|.|.:.|  ::.|.|||.|:|.::|..|..   :.......|:|| 
  Fly    10 RMNDFEVASPPDDSVSALEFSPSTVQKNFLVAGSWDSTVRCWEVEQNGATVPKSMKTMGGPVLDV 74

  Fly    61 CAFMDIVHVVSGSLDNQLRLFDVNTQAESIIGAHEEPIRCVEHAEYVNG-----ILTGSWDNTVK 120
            |...|...|...|.|.|::|:|:.:.....:.||:.|::.   ...|.|     ::|||||.|:|
  Fly    75 CWSDDGSKVFVASCDKQVKLWDLASDQVMQVAAHDGPVKT---CHMVKGPTYTCLMTGSWDKTLK 136

  Fly   121 LWDMREKRCVGTFEQNNGKVYSMSVIDEKIVVATSDRKVLIWDLRKMDSYIMKRESSLKYQTRCI 185
            .||.|....:.|..... :.|...|.....||.|::|.::|:.|:...:...::||.||||.|.|
  Fly   137 FWDTRSPNPMMTINLPE-RCYCADVEYPMAVVGTANRGLIIYSLQNSPTEYKRQESPLKYQHRAI 200

  Fly   186 RLFPNKE----GYVMSSIEGRVAVEYLDHDPEVQRRKFAFKCHRNR-EQNIEQIYPVNALSFHNV 245
            .:|.:|:    |..:.|||||||::|:  :|...:..|.|||||.. ....:.||.||.::||.|
  Fly   201 SIFRDKKKEPTGCALGSIEGRVAIQYV--NPGNPKDNFTFKCHRTTGTSGYQDIYAVNDIAFHPV 263

  Fly   246 YQTFATGGSDGIVNIWDGFNKKRLCQFHEYDTSISTLNFSSDGSALAIGCSY 297
            :.|..|.||||..:.||...:.:|......|.||:...|:::|...|....|
  Fly   264 HGTLVTVGSDGTFSFWDKDARTKLKSSETMDQSITKCGFNANGQIFAYAVGY 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bub3NP_001287587.1 WD40 <10..296 CDD:225201 99/301 (33%)
WD40 16..262 CDD:295369 87/261 (33%)
WD40 repeat 16..53 CDD:293791 13/41 (32%)
WD40 repeat 59..93 CDD:293791 10/34 (29%)
WD40 repeat 98..134 CDD:293791 13/40 (33%)
WD40 repeat 141..175 CDD:293791 8/33 (24%)
WD40 repeat 182..222 CDD:293791 15/43 (35%)
WD40 repeat 237..283 CDD:293791 17/45 (38%)
Rae1NP_611597.1 WD40 22..310 CDD:421866 96/293 (33%)
WD40 repeat 25..66 CDD:293791 13/40 (33%)
WD40 repeat 71..105 CDD:293791 10/33 (30%)
WD40 repeat 113..150 CDD:293791 13/39 (33%)
WD40 repeat 157..239 CDD:293791 28/83 (34%)
WD40 repeat 255..293 CDD:293791 14/37 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447787
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1048963at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10971
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.